Recombinant Human FIP1/RCP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FIP1/RCP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 540-649 of Human RAB11FIP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PRLHPVKPMNATATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEETPNILRIPTQVGKKAGKM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB11FIP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FIP1/RCP Protein

  • DKFZp686E2214
  • EC 3.2.1.28
  • EC 6.1.1.7
  • FLJ22524
  • FLJ22622
  • MGC78448
  • NOEL1A
  • RAB11 coupling protein
  • RAB11 family interacting protein 1 (class I)
  • rab11 family-interacting protein 1
  • Rab11-FIP1
  • Rab-coupling protein
  • Rab-interacting recycling protein
  • RCPRab effector protein

Background

Proteins of the large Rab GTPase family (see RAB1A; MIM 179508) have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP1 is one of many proteins that interact with and regulate Rab GTPases (Hales et al., 2001 [PubMed 11495908]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-84495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
AF6428
Species: Hu
Applications: WB, IHC
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-74730
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-91937
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00080223-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FIP1/RCP Partial Recombinant Protein (H00080223-Q01) (0)

There are no publications for FIP1/RCP Partial Recombinant Protein (H00080223-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FIP1/RCP Partial Recombinant Protein (H00080223-Q01) (0)

There are no reviews for FIP1/RCP Partial Recombinant Protein (H00080223-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FIP1/RCP Partial Recombinant Protein (H00080223-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FIP1/RCP Products

Bioinformatics Tool for FIP1/RCP Partial Recombinant Protein (H00080223-Q01)

Discover related pathways, diseases and genes to FIP1/RCP Partial Recombinant Protein (H00080223-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIP1/RCP Partial Recombinant Protein (H00080223-Q01)

Discover more about diseases related to FIP1/RCP Partial Recombinant Protein (H00080223-Q01).
 

Pathways for FIP1/RCP Partial Recombinant Protein (H00080223-Q01)

View related products by pathway.

PTMs for FIP1/RCP Partial Recombinant Protein (H00080223-Q01)

Learn more about PTMs related to FIP1/RCP Partial Recombinant Protein (H00080223-Q01).

Blogs on FIP1/RCP

There are no specific blogs for FIP1/RCP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FIP1/RCP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB11FIP1