FIG4 Antibody - BSA Free

Western Blot: FIG4 Antibody [NBP2-84935] - Host: Rabbit. Target Name: FIG4. Sample Tissue: Human Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FIG4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FIG4. Peptide sequence: PISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FIG4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FIG4 Antibody - BSA Free

• ALS11polyphosphoinositide phosphatase
• CMT4J
• dJ249I4.1
• EC 3.1.3
• EC 3.1.3.-
• EC 3.1.3.36
• FIG4 homolog (S. cerevisiae)
• FIG4 homolog, SAC1 lipid phosphatase domain containing (S. cerevisiae)
• hSac3
• KIAA0274FIG4 homolog, SAC domain containing lipid phosphatase
• Phosphatidylinositol 3,5-bisphosphate 5-phosphatase
• Sac domain-containing inositol phosphatase 3
• SAC domain-containing protein 3
• SAC3FIG4 homolog, SAC1 domain containing lipid phosphatase

Background

The protein encoded by the FIG4 gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FIG4