Fibrinopeptide B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Fibrinopeptide B Antibody [NBP3-35409] - Immunofluorescence analysis of HepG2 cells using Fibrinopeptide B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] - Western blot analysis of lysates from HepG2 cells, using Fibrinopeptide B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Western Blot: Fibrinopeptide B Antibody [NBP3-35409] - Western blot analysis of various lysates using Fibrinopeptide B Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Fibrinopeptide B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Fibrinopeptide B Antibody - BSA Free (NBP3-35409) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).
  
  Sequence:
  QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FGB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for Fibrinopeptide B Antibody - BSA Free

• Beta-Fibrinogen
• FGB Peptide
• FIBB
• Fibrinogen beta chain
• Fibrinogen Type II
• fibrinogen, B beta polypeptide
• Fibrinopeptide B
• FPB
• MGC104327
• MGC120405

Background

The protein encoded by the Fibrinopeptide B gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of threepairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrinwhich is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrinregulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for severalcell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia,hypodysfibrinogenemia and thrombotic tendency. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGB