Fibrinopeptide B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Fibrinopeptide B Antibody - BSA Free (NBP3-35409) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 111-222 of human Fibrinopeptide B (NP_005132.2).
Sequence: QLQEALLQQERPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Fibrinopeptide B Antibody - BSA Free
Background
The protein encoded by the Fibrinopeptide B gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of threepairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrinwhich is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrinregulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for severalcell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia,hypodysfibrinogenemia and thrombotic tendency. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF (-), IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for Fibrinopeptide B Antibody (NBP3-35409) (0)
There are no publications for Fibrinopeptide B Antibody (NBP3-35409).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fibrinopeptide B Antibody (NBP3-35409) (0)
There are no reviews for Fibrinopeptide B Antibody (NBP3-35409).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fibrinopeptide B Antibody (NBP3-35409) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fibrinopeptide B Products
Research Areas for Fibrinopeptide B Antibody (NBP3-35409)
Find related products by research area.
|
Blogs on Fibrinopeptide B