Fibrinopeptide B Antibody

Images

 
Western Blot: Fibrinopeptide B Antibody [NBP1-90955] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: ...read more
Immunohistochemistry-Paraffin: Fibrinopeptide B Antibody [NBP1-90955] - Staining of human placenta shows extracellular positivity in blood vessels and cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fibrinopeptide B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fibrinopeptide B Protein (NBP1-90955PEP)
Publications
Read Publications using NBP1-90955.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibrinopeptide B Antibody

  • Beta-Fibrinogen
  • FGB Peptide
  • FIBB
  • Fibrinogen beta chain
  • Fibrinogen Type II
  • fibrinogen, B beta polypeptide
  • Fibrinopeptide B
  • FPB
  • MGC104327
  • MGC120405

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2338
Species: Hu
Applications: WB, IP, ICC
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF4409
Species: Mu
Applications: WB
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-90955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Fibrinopeptide B Antibody (NBP1-90955)(2)

Reviews for Fibrinopeptide B Antibody (NBP1-90955) (0)

There are no reviews for Fibrinopeptide B Antibody (NBP1-90955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrinopeptide B Antibody (NBP1-90955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibrinopeptide B Products

Bioinformatics Tool for Fibrinopeptide B Antibody (NBP1-90955)

Discover related pathways, diseases and genes to Fibrinopeptide B Antibody (NBP1-90955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrinopeptide B Antibody (NBP1-90955)

Discover more about diseases related to Fibrinopeptide B Antibody (NBP1-90955).
 

Pathways for Fibrinopeptide B Antibody (NBP1-90955)

View related products by pathway.

PTMs for Fibrinopeptide B Antibody (NBP1-90955)

Learn more about PTMs related to Fibrinopeptide B Antibody (NBP1-90955).
 

Research Areas for Fibrinopeptide B Antibody (NBP1-90955)

Find related products by research area.

Blogs on Fibrinopeptide B

There are no specific blogs for Fibrinopeptide B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibrinopeptide B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGB
Entrez