![Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cerebral cortex, liver, placenta and rectum using Fibrinogen beta chain antibody NBP1-90955 (A) shows similar protein distribution across tissues to independent antibody NBP1-90956 (B).](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90955-img0007.jpg "Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cerebral cortex, liver, placenta and rectum using Fibrinogen beta chain antibody NBP1-90955 (A) shows similar protein distribution across tissues to independent antibody NBP1-90956 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQC |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FGB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Fibrinogen beta chain Antibody (NBP1-90955)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FGB |
![Western Blot: Fibrinogen beta chain Antibody [NBP1-90955] - Analysis using Fibrinogen beta chain antibody NBP1-90955 (A) shows similar pattern to independent antibody NBP1-90956 (B).](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Western-Blot-NBP1-90955-img0008.jpg "Western Blot: Fibrinogen beta chain Antibody [NBP1-90955] - Analysis using Fibrinogen beta chain antibody NBP1-90955 (A) shows similar pattern to independent antibody NBP1-90956 (B).")
![Immunocytochemistry/Immunofluorescence: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90955-img0006.jpg "Immunocytochemistry/Immunofluorescence: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cell line Hep G2 shows localization to endoplasmic reticulum.")
![Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90955-img0011.jpg "Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90955-img0009.jpg "Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human placenta shows strong positivity in plasma in blood vessels.](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90955-img0010.jpg "Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human placenta shows strong positivity in plasma in blood vessels.")
![Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human rectum shows moderate positivity in plasma in blood vessels, as well as positivity in extracellular matrix.](http://images.novusbio.com/fullsize/Fibrinopeptide-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90955-img0012.jpg "Immunohistochemistry-Paraffin: Fibrinogen beta chain Antibody [NBP1-90955] - Staining of human rectum shows moderate positivity in plasma in blood vessels, as well as positivity in extracellular matrix.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot Coagulation Factor VII Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_VII_AF2338_Immunocytochemistry__Immunofluorescence_17302.jpg)
![Immunocytochemistry Coagulation Factor VII Antibody [Unconjugated]](https://images.novusbio.com/images2/Coagulation_Factor_VII_AF2338_Immunocytochemistry__Immunofluorescence_17395.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")