FHOD3 Antibody

Images

 
Immunohistochemistry-Paraffin: FHOD3 Antibody [NBP1-83898] Staining of human cerebral cortex shows cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FHOD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHOD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FHOD3 Protein (NBP1-83898PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FHOD3 Antibody

  • FH1/FH2 domain-containing protein 3
  • FHOS2
  • Formactin2
  • formactin-2
  • formin homolog overexpressed in spleen 2
  • formin homology 2 domain containing 3
  • hFHOS2
  • KIAA1695

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83900
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24724
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
NB600-230
Species: Hu
Applications: WB
NBP2-24615
Species: Hu
Applications: WB, IHC-P
NBP2-24536
Species: Hu, Mu
Applications: WB
NBP1-94174
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24623
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93579
Species: Hu
Applications: IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP1-86739
Species: Hu
Applications: IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-83898
Species: Hu
Applications: IHC, IHC-P

Publications for FHOD3 Antibody (NBP1-83898) (0)

There are no publications for FHOD3 Antibody (NBP1-83898).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHOD3 Antibody (NBP1-83898) (0)

There are no reviews for FHOD3 Antibody (NBP1-83898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FHOD3 Antibody (NBP1-83898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHOD3 Products

Bioinformatics Tool for FHOD3 Antibody (NBP1-83898)

Discover related pathways, diseases and genes to FHOD3 Antibody (NBP1-83898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHOD3 Antibody (NBP1-83898)

Discover more about diseases related to FHOD3 Antibody (NBP1-83898).
 

Pathways for FHOD3 Antibody (NBP1-83898)

View related products by pathway.

PTMs for FHOD3 Antibody (NBP1-83898)

Learn more about PTMs related to FHOD3 Antibody (NBP1-83898).

Blogs on FHOD3

There are no specific blogs for FHOD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHOD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHOD3