FHL2 Antibody (2G3-1A5)

Images

 
Western Blot: FHL2 Antibody (2G3-1A5) [H00002274-M01] - FHL2 monoclonal antibody (M01), clone 2G3-1A5 Analysis of FHL2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: FHL2 Antibody (2G3-1A5) [H00002274-M01] - Analysis of monoclonal antibody to FHL2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2G3-1A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FHL2 Antibody (2G3-1A5) Summary

Immunogen
FHL2 (AAH14397, 1 a.a. - 279 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Specificity
FHL2 - four and a half LIM domains 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FHL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FHL2 Antibody (2G3-1A5)

  • AAG11
  • down-regulated in rhabdomyosarcoma LIM protein
  • DRAL
  • DRALAAG11
  • FHL2
  • FHL-2
  • four and a half LIM domains 2
  • four and a half LIM domains protein 2
  • four and a half LIM-domain protein 2
  • LIM domain protein DRAL
  • Skeletal muscle LIM-protein 3
  • SLIM3
  • SLIM-3
  • SLIM3aging-associated gene 11

Background

LIM proteins contain a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-26395
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-86122
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF5900
Species: Hu
Applications: WB
AF4779
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00002274-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for FHL2 Antibody (H00002274-M01) (0)

There are no publications for FHL2 Antibody (H00002274-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHL2 Antibody (H00002274-M01) (0)

There are no reviews for FHL2 Antibody (H00002274-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FHL2 Antibody (H00002274-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHL2 Products

Bioinformatics Tool for FHL2 Antibody (H00002274-M01)

Discover related pathways, diseases and genes to FHL2 Antibody (H00002274-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHL2 Antibody (H00002274-M01)

Discover more about diseases related to FHL2 Antibody (H00002274-M01).
 

Pathways for FHL2 Antibody (H00002274-M01)

View related products by pathway.

PTMs for FHL2 Antibody (H00002274-M01)

Learn more about PTMs related to FHL2 Antibody (H00002274-M01).

Blogs on FHL2

There are no specific blogs for FHL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHL2 Antibody (2G3-1A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FHL2
Entrez
OMIM
Uniprot