FHL1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FHL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 16524965)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FHL1 Antibody - BSA Free
Background
LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Publications for FHL1 Antibody (NBP1-88746)(1)
Showing Publication 1 -
1 of 1.
Reviews for FHL1 Antibody (NBP1-88746) (0)
There are no reviews for FHL1 Antibody (NBP1-88746).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FHL1 Antibody (NBP1-88746) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FHL1 Products
Research Areas for FHL1 Antibody (NBP1-88746)
Find related products by research area.
|
Blogs on FHL1