FGFR1OP2 Antibody

Images

 
Western Blot: FGFR1OP2 Antibody [NBP1-84149] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: FGFR1OP2 Antibody [NBP1-84149] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGFR1OP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NELQAHVDQITEMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLSALVTNSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGFR1OP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGFR1OP2 Protein (NBP1-84149PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGFR1OP2 Antibody

  • DKFZp564O1863
  • DKFZp586C1423
  • FGFR1 oncogene partner 2
  • fibroblast growth factor receptor 1 oncogene partner 2
  • FLJ37569
  • HSPC123-like
  • WIT3.0
  • wound inducible transcript 3.0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-81435
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81397
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011140-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32528PEP
Species: Hu
Applications: AC
NBP1-47195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74571
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32030
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FGFR1OP2 Antibody (NBP1-84149) (0)

There are no publications for FGFR1OP2 Antibody (NBP1-84149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGFR1OP2 Antibody (NBP1-84149) (0)

There are no reviews for FGFR1OP2 Antibody (NBP1-84149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGFR1OP2 Antibody (NBP1-84149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGFR1OP2 Products

Bioinformatics Tool for FGFR1OP2 Antibody (NBP1-84149)

Discover related pathways, diseases and genes to FGFR1OP2 Antibody (NBP1-84149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGFR1OP2 Antibody (NBP1-84149)

Discover more about diseases related to FGFR1OP2 Antibody (NBP1-84149).
 

Pathways for FGFR1OP2 Antibody (NBP1-84149)

View related products by pathway.

PTMs for FGFR1OP2 Antibody (NBP1-84149)

Learn more about PTMs related to FGFR1OP2 Antibody (NBP1-84149).
 

Research Areas for FGFR1OP2 Antibody (NBP1-84149)

Find related products by research area.

Blogs on FGFR1OP2

There are no specific blogs for FGFR1OP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGFR1OP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR1OP2