FGFR1OP Antibody

Western Blot: FGFR1OP Antibody [H00011116-B01P] - Analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP polyclonal antibody. Lane 1: FGFR1OP transfected lysate(43.89 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: FGFR1OP Antibody [H00011116-B01P] - Analysis of purified antibody to FGFR1OP on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

FGFR1OP Antibody Summary

• Immunogen: FGFR1OP (NP_008976.1, 1 a.a. - 399 a.a.) full-length human protein. MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
• Specificity: FGFR1OP - FGFR1 oncogene partner,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CEP43
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGFR1OP Antibody

• FGFR1 oncogene partner
• FOPfibroblast growth factor receptor 1 oncogene partner

Background

This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEP43
• Entrez:
  • 11116(Human)
• Uniprot:
  • NP_008976.1(Human)