Recombinant Human FGF acidic/FGF1 Protein

Product Discontinued

Recombinant Human FGF acidic/FGF1 Protein Summary

• Description: Recombinant biologically active FGF1 protein.

  Source:E. coli

  Amino Acid Sequence: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

• Details of Functionality: Recombinant FGF-1 is fully biologically active when compared to standards.The ED50, calculated by the dose-dependant proliferation of mouse BALB/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2,000,000 IU/mg.
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: FGF1
• Purity: >95%, by HPLC.
• Endotoxin Note: Less than 0.1 ng/ug (IEU/ug) of FGF-acidic .

Applications/Dilutions

• Dilutions:
  • Bioactivity
• Theoretical MW: 15.8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized from PBS.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: >95%, by HPLC.
• Reconstitution Instructions: Reconstitute the lyophilized Fibroblast Growth Factor-acidic in sterile 18 M omega-cm water at 4 degrees Celsius at a concentration of 0.1 mg-0.25 mg per 1ml. Allow sample to sit for 5 min. at 4 degrees, spin to remove precipitant.

Notes

After reconstitution, store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Alternate Names for Recombinant Human FGF acidic/FGF1 Protein

• AFGF
• alpha
• alpha-ECGF
• beta-ECGF
• ECGF
• ECGFB
• ECGF-betaAcidic fibroblast growth factor
• endothelial cell growth factor, beta
• FGF acidic
• FGF-1
• FGFABeta-endothelial cell growth factor
• FGF-alpha
• fibroblast growth factor 1 (acidic)
• GLIO703
• HBGF1
• HBGF-1
• heparin-binding growth factor 1

Background

Acidic fibroblast growth factor is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described. The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FGF1