FGF acidic/FGF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody [NBP1-89213] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FGF acidic/FGF1 Antibody [NBP1-89213] - Staining of human kidney shows distinct cytoplasmic positivity in tubule cells and glomeruli.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGF acidic/FGF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FGF acidic/FGF1 Protein (NBP1-89213PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGF acidic/FGF1 Antibody

  • AFGF
  • alpha
  • alpha-ECGF
  • beta-ECGF
  • ECGF
  • ECGFB
  • ECGF-betaAcidic fibroblast growth factor
  • endothelial cell growth factor, beta
  • FGF acidic
  • FGF1
  • FGF-1
  • FGFABeta-endothelial cell growth factor
  • FGF-alpha
  • fibroblast growth factor 1 (acidic)
  • GLIO703
  • HBGF1
  • HBGF-1
  • heparin-binding growth factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2265
Species: Mu
Applications: WB, IHC

Publications for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no publications for FGF acidic/FGF1 Antibody (NBP1-89213).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no reviews for FGF acidic/FGF1 Antibody (NBP1-89213). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF acidic/FGF1 Products

Bioinformatics Tool for FGF acidic/FGF1 Antibody (NBP1-89213)

Discover related pathways, diseases and genes to FGF acidic/FGF1 Antibody (NBP1-89213). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF acidic/FGF1 Antibody (NBP1-89213)

Discover more about diseases related to FGF acidic/FGF1 Antibody (NBP1-89213).
 

Pathways for FGF acidic/FGF1 Antibody (NBP1-89213)

View related products by pathway.

PTMs for FGF acidic/FGF1 Antibody (NBP1-89213)

Learn more about PTMs related to FGF acidic/FGF1 Antibody (NBP1-89213).

Blogs on FGF acidic/FGF1

There are no specific blogs for FGF acidic/FGF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF acidic/FGF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF1
Entrez