FGF acidic/FGF1 Antibody


Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody [NBP1-89213] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FGF acidic/FGF1 Antibody [NBP1-89213] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: FGF acidic/FGF1 Antibody [NBP1-89213] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: FGF acidic/FGF1 Antibody [NBP1-89213] - Staining in human kidney and skeletal muscle tissues using anti-FGF1 antibody. Corresponding FGF1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FGF acidic/FGF1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Specificity of human FGF acidic/FGF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FGF acidic/FGF1 Protein (NBP1-89213PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FGF acidic/FGF1 Antibody

  • AFGF
  • alpha
  • alpha-ECGF
  • beta-ECGF
  • ECGF
  • ECGF-betaAcidic fibroblast growth factor
  • endothelial cell growth factor, beta
  • FGF acidic
  • FGF1
  • FGF-1
  • FGFABeta-endothelial cell growth factor
  • FGF-alpha
  • fibroblast growth factor 1 (acidic)
  • GLIO703
  • HBGF1
  • HBGF-1
  • heparin-binding growth factor 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC

Publications for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no publications for FGF acidic/FGF1 Antibody (NBP1-89213).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no reviews for FGF acidic/FGF1 Antibody (NBP1-89213). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FGF acidic/FGF1 Antibody (NBP1-89213) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF acidic/FGF1 Products

Bioinformatics Tool for FGF acidic/FGF1 Antibody (NBP1-89213)

Discover related pathways, diseases and genes to FGF acidic/FGF1 Antibody (NBP1-89213). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF acidic/FGF1 Antibody (NBP1-89213)

Discover more about diseases related to FGF acidic/FGF1 Antibody (NBP1-89213).

Pathways for FGF acidic/FGF1 Antibody (NBP1-89213)

View related products by pathway.

PTMs for FGF acidic/FGF1 Antibody (NBP1-89213)

Learn more about PTMs related to FGF acidic/FGF1 Antibody (NBP1-89213).

Blogs on FGF acidic/FGF1

There are no specific blogs for FGF acidic/FGF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF acidic/FGF1 Antibody and receive a gift card or discount.


Gene Symbol FGF1