FGF-9 Recombinant Protein Antigen

Images

 
There are currently no images for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FGF-9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF9.

Source: E. coli

Amino Acid Sequence: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FGF9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62653.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FGF-9 Recombinant Protein Antigen

  • FGF9
  • FGF-9
  • fibroblast growth factor 9 (glia-activating factor)
  • Fibroblast growth factor 9
  • GAF
  • glia-activating factor
  • HBFG-9
  • HBGF-9
  • Heparin-binding growth factor 9
  • MGC119914
  • MGC119915
  • SYNS3

Background

The protein encoded by the FGF9 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possessbroad mitogenic and cell survival activities, and are involved in a variety of biological processes, includingembryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolatedas a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, thisprotein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homologof this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed amale-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

233-FB
Species: Hu
Applications: BA
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
MAB7662
Species: Hu
Applications: Flow, ICC, IHC, WB
345-FG
Species: Hu
Applications: BA
251-KG
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA
AF232
Species: Hu
Applications: IHC, Neut, Simple Western, WB
235-F4
Species: Hu
Applications: BA
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-16471
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
8988-F18
Species: Hu
Applications: BA
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1212
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-62653PEP
Species: Hu
Applications: AC

Publications for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)

There are no publications for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)

There are no reviews for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FGF-9 Products

Research Areas for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP)

Find related products by research area.

Blogs on FGF-9

There are no specific blogs for FGF-9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FGF-9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF9