FGF-5 Antibody (1B4)

Images

 
Western Blot: FGF-5 Antibody (1B4) [H00002250-M01] - FGF5 monoclonal antibody (M01), clone 1B4. Analysis of FGF5 expression in human colon.
Proximity Ligation Assay: FGF-5 Antibody (1B4) [H00002250-M01] - Analysis of protein-protein interactions between FGFR2 and FGF5. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF5 ...read more
Immunoprecipitation: FGF-5 Antibody (1B4) [H00002250-M01] - Analysis of FGF5 transfected lysate using anti-FGF5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF5 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: FGF-5 Antibody (1B4) [H00002250-M01] - Detection limit for recombinant GST tagged FGF5 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP, PLA
Clone
1B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGF-5 Antibody (1B4) Summary

Immunogen
FGF5 (NP_004455.2 159 a.a. - 268 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Specificity
Reacts with fibroblast growth factor 5.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGF5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
  • Proximity Ligation Assay
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-5 Antibody (1B4)

  • FGF5
  • FGF-5
  • fibroblast growth factor 5
  • HBGF-5
  • Heparin-binding growth factor 5
  • Smag-82

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-237-NA
Species: Hu
Applications: WB, IHC, Neut
232-FA/CF
Species: Hu
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF238
Species: Hu
Applications: WB, Neut
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF2265
Species: Mu
Applications: WB, IHC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for FGF-5 Antibody (H00002250-M01) (0)

There are no publications for FGF-5 Antibody (H00002250-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-5 Antibody (H00002250-M01) (0)

There are no reviews for FGF-5 Antibody (H00002250-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-5 Antibody (H00002250-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-5 Products

Bioinformatics Tool for FGF-5 Antibody (H00002250-M01)

Discover related pathways, diseases and genes to FGF-5 Antibody (H00002250-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-5 Antibody (H00002250-M01)

Discover more about diseases related to FGF-5 Antibody (H00002250-M01).
 

Pathways for FGF-5 Antibody (H00002250-M01)

View related products by pathway.

PTMs for FGF-5 Antibody (H00002250-M01)

Learn more about PTMs related to FGF-5 Antibody (H00002250-M01).
 

Research Areas for FGF-5 Antibody (H00002250-M01)

Find related products by research area.

Blogs on FGF-5

There are no specific blogs for FGF-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-5 Antibody (1B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF5
Entrez
Uniprot