FGF-12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FGF-12 Antibody [NBP2-57305] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGF-12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS
Specificity
Specificity of human FGF-12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FGF-12 Recombinant Protein Antigen (NBP2-57305PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FGF-12 Antibody

  • FGF12
  • FGF-12
  • FGF12B
  • FHF1
  • FHF-1
  • FHF1Fibroblast growth factor homologous factor 1
  • fibroblast growth factor 12
  • fibroblast growth factor 12B
  • fibroblast growth factor FGF-12b
  • Myocyte-activating factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82600
Species: Hu
Applications: IHC, IHC-P
MAB319
Species: Hu
Applications: WB, IHC
NBP2-55745
Species: Hu
Applications: ICC/IF
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
MAB7662
Species: Hu
Applications: WB, IHC, ICC
AF1634
Species: Hu
Applications: WB
AF238
Species: Hu
Applications: WB, Neut
NB300-137
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-48848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31411
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1085
Species: Mu
Applications: WB, IHC, Neut

Publications for FGF-12 Antibody (NBP2-57305) (0)

There are no publications for FGF-12 Antibody (NBP2-57305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-12 Antibody (NBP2-57305) (0)

There are no reviews for FGF-12 Antibody (NBP2-57305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FGF-12 Antibody (NBP2-57305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FGF-12 Antibody (NBP2-57305)

Discover related pathways, diseases and genes to FGF-12 Antibody (NBP2-57305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-12 Antibody (NBP2-57305)

Discover more about diseases related to FGF-12 Antibody (NBP2-57305).
 

Pathways for FGF-12 Antibody (NBP2-57305)

View related products by pathway.

PTMs for FGF-12 Antibody (NBP2-57305)

Learn more about PTMs related to FGF-12 Antibody (NBP2-57305).
 

Research Areas for FGF-12 Antibody (NBP2-57305)

Find related products by research area.

Blogs on FGF-12

There are no specific blogs for FGF-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF12
Entrez