FGD3 Antibody

Images

 
Immunohistochemistry: FGD3 Antibody [NBP2-30845] - Staining of human tonsil shows strong positivity in a subset of leukocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIGPTGELSGSLKIPNRDSGIDSPSSSVAGE
Specificity
Specificity of human FGD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGD3 Protein (NBP2-30845PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGD3 Antibody

  • FGD1 family, member 3
  • FLJ00004
  • FYVE, RhoGEF and PH domain containing 3
  • FYVE, RhoGEF and PH domain-containing protein 3
  • GCCD2
  • GCCD3
  • MGC117260
  • ZFYVE5faciogenital dysplasia 3
  • Zinc finger FYVE domain-containing protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61712
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80600
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF3485
Species: Hu, Pm
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for FGD3 Antibody (NBP2-30845) (0)

There are no publications for FGD3 Antibody (NBP2-30845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGD3 Antibody (NBP2-30845) (0)

There are no reviews for FGD3 Antibody (NBP2-30845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGD3 Antibody (NBP2-30845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FGD3 Products

Bioinformatics Tool for FGD3 Antibody (NBP2-30845)

Discover related pathways, diseases and genes to FGD3 Antibody (NBP2-30845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGD3 Antibody (NBP2-30845)

Discover more about diseases related to FGD3 Antibody (NBP2-30845).
 

Pathways for FGD3 Antibody (NBP2-30845)

View related products by pathway.

PTMs for FGD3 Antibody (NBP2-30845)

Learn more about PTMs related to FGD3 Antibody (NBP2-30845).

Blogs on FGD3

There are no specific blogs for FGD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGD3
Uniprot