FGD2 Antibody

Images

 
Western Blot: FGD2 Antibody [NBP1-80600] - Analysis in control (vector only transfected HEK293T lysate) and FGD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: FGD2 Antibody [NBP1-80600] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQEL
Specificity
Specificity of human FGD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FGD2 Protein (NBP1-80600PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGD2 Antibody

  • FGD1 family, member 2
  • FLJ00048
  • FLJ00276 protein
  • FLJ40929
  • FYVE, RhoGEF and PH domain containing 2
  • FYVE, RhoGEF and PH domain-containing protein 2
  • ZFYVE4MGC71330
  • Zinc finger FYVE domain-containing protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83906
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-30913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-76802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77222
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA

Publications for FGD2 Antibody (NBP1-80600) (0)

There are no publications for FGD2 Antibody (NBP1-80600).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGD2 Antibody (NBP1-80600) (0)

There are no reviews for FGD2 Antibody (NBP1-80600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGD2 Antibody (NBP1-80600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FGD2 Antibody (NBP1-80600)

Discover related pathways, diseases and genes to FGD2 Antibody (NBP1-80600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGD2 Antibody (NBP1-80600)

Discover more about diseases related to FGD2 Antibody (NBP1-80600).
 

Pathways for FGD2 Antibody (NBP1-80600)

View related products by pathway.

Blogs on FGD2

There are no specific blogs for FGD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGD2