FGD1 Antibody

Images

 
Western Blot: FGD1 Antibody [NBP1-79979] - Raji cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: FGD1 Antibody [NBP1-79979] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGD1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human FGD1. Peptide sequence WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against FGD1 and was validated on Western blot.
Theoretical MW
107 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGD1 Antibody

  • faciogenital dysplasia (Aarskog-ScRhoGEF and PH domain-containing protein 1
  • Faciogenital dysplasia 1 protein
  • FGDYMRXS16
  • FYVE, RhoGEF and PH domain containing 1
  • Rho/Rac guanine nucleotide exchange factor FGD1
  • ZFYVE3AAS
  • Zinc finger FYVE domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
7268-CT
NBP1-85467
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-79979
Species: Hu
Applications: WB, IHC

Publications for FGD1 Antibody (NBP1-79979) (0)

There are no publications for FGD1 Antibody (NBP1-79979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGD1 Antibody (NBP1-79979) (0)

There are no reviews for FGD1 Antibody (NBP1-79979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGD1 Antibody (NBP1-79979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FGD1 Antibody (NBP1-79979)

Discover related pathways, diseases and genes to FGD1 Antibody (NBP1-79979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGD1 Antibody (NBP1-79979)

Discover more about diseases related to FGD1 Antibody (NBP1-79979).
 

Pathways for FGD1 Antibody (NBP1-79979)

View related products by pathway.

PTMs for FGD1 Antibody (NBP1-79979)

Learn more about PTMs related to FGD1 Antibody (NBP1-79979).

Blogs on FGD1

There are no specific blogs for FGD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGD1
Uniprot