Recombinant Human FECH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FECH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human FECH partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL

Protein/Peptide Type
Partial Recombinant Protein
Gene
FECH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FECH Protein

  • EC 4.99.1.1
  • EPP
  • FCE
  • ferrochelatase (protoporphyria)
  • ferrochelatase
  • ferrochelatase, mitochondrial
  • Heme synthase
  • heme synthetase
  • Protoheme ferro-lyase
  • protoporphyria

Background

FECH - ferrochelatase (protoporphyria)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for FECH Partial Recombinant Protein (H00002235-Q01) (0)

There are no publications for FECH Partial Recombinant Protein (H00002235-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FECH Partial Recombinant Protein (H00002235-Q01) (0)

There are no reviews for FECH Partial Recombinant Protein (H00002235-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FECH Partial Recombinant Protein (H00002235-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FECH Products

Bioinformatics Tool for FECH Partial Recombinant Protein (H00002235-Q01)

Discover related pathways, diseases and genes to FECH Partial Recombinant Protein (H00002235-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FECH Partial Recombinant Protein (H00002235-Q01)

Discover more about diseases related to FECH Partial Recombinant Protein (H00002235-Q01).
 

Pathways for FECH Partial Recombinant Protein (H00002235-Q01)

View related products by pathway.

PTMs for FECH Partial Recombinant Protein (H00002235-Q01)

Learn more about PTMs related to FECH Partial Recombinant Protein (H00002235-Q01).
 

Research Areas for FECH Partial Recombinant Protein (H00002235-Q01)

Find related products by research area.

Blogs on FECH

There are no specific blogs for FECH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
FECH Antibody
NBP2-33413

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FECH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FECH