FECH Antibody

Images

 
Western Blot: FECH Antibody [H00002235-B01P] - Analysis of FECH expression in human liver.
Western Blot: FECH Antibody [H00002235-B01P] - Analysis of FECH expression in transfected 293T cell line by FECH polyclonal antibody. Lane 1: FECH transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FECH Antibody Summary

Immunogen
FECH (NP_000131.2, 1 a.a. - 423 a.a.) full-length human protein. MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FECH
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FECH Antibody

  • EC 4.99.1.1
  • EPP
  • FCE
  • ferrochelatase (protoporphyria)
  • ferrochelatase
  • ferrochelatase, mitochondrial
  • Heme synthase
  • heme synthetase
  • Protoheme ferro-lyase
  • protoporphyria

Background

The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for FECH Antibody (H00002235-B01P) (0)

There are no publications for FECH Antibody (H00002235-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FECH Antibody (H00002235-B01P) (0)

There are no reviews for FECH Antibody (H00002235-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FECH Antibody (H00002235-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FECH Products

Bioinformatics Tool for FECH Antibody (H00002235-B01P)

Discover related pathways, diseases and genes to FECH Antibody (H00002235-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FECH Antibody (H00002235-B01P)

Discover more about diseases related to FECH Antibody (H00002235-B01P).
 

Pathways for FECH Antibody (H00002235-B01P)

View related products by pathway.

PTMs for FECH Antibody (H00002235-B01P)

Learn more about PTMs related to FECH Antibody (H00002235-B01P).
 

Research Areas for FECH Antibody (H00002235-B01P)

Find related products by research area.

Blogs on FECH

There are no specific blogs for FECH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FECH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FECH
Uniprot