FCRN/FCGRT Recombinant Protein Antigen

Images

 
There are currently no images for FCRN/FCGRT Protein (NBP1-89127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FCRN/FCGRT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FCGRT.

Source: E. coli

Amino Acid Sequence: LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FCGRT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FCRN/FCGRT Recombinant Protein Antigen

  • alpha-chain
  • Fc fragment of IgG, receptor, transporter, alpha
  • FCGRT
  • FcRn alpha chain
  • FCRN
  • FCRNimmunoglobulin receptor, intestinal, heavy chain
  • IgG Fc fragment receptor transporter alpha chain
  • IgG receptor FcRn large subunit p51
  • major histocompatibility complex class I-like Fc receptor
  • Neonatal Fc receptor
  • neonatal Fc-receptor for Ig

Background

The FCGRT gene encodes a 365 amino acid long, 39 kDA IgG receptor FcRn large subunit p51 protein that transfers immunoglobulin G antibodies across the placenta from mother to fetus, as well as functions to protect the antibody from degradation. FCGRT interacts with genes CA6, ELANE, AZGP1, B2M, and ALB. It has been linked to diseases such as: lupus, nephritis, leukemia, arthritis, immunodeficiency, epidermolysis bullosa acquisita, persistent fetal circulation syndrome, and pemphigus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
4325-FC
Species: Hu
Applications: Bind
MEP00B
Species: Mu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP2-46123
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NB100-64852
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
1257-FC
Species: Hu
Applications: Bind
NBP1-83250
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89127PEP
Species: Hu
Applications: AC

Publications for FCRN/FCGRT Protein (NBP1-89127PEP) (0)

There are no publications for FCRN/FCGRT Protein (NBP1-89127PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRN/FCGRT Protein (NBP1-89127PEP) (0)

There are no reviews for FCRN/FCGRT Protein (NBP1-89127PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FCRN/FCGRT Protein (NBP1-89127PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FCRN/FCGRT Products

Research Areas for FCRN/FCGRT Protein (NBP1-89127PEP)

Find related products by research area.

Blogs on FCRN/FCGRT.

FcRn - neonatal Fc receptor encoded by the FCGRT gene
Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FCRN/FCGRT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGRT