FCRL1/FcRH1 Antibody

Images

 
Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells and immune cells.
Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: FCRL1/FcRH1 Antibody [NBP1-84703] - Staining in human lymph node and cerebral cortex tissues using anti-FCRL1 antibody. Corresponding FCRL1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCRL1/FcRH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSL
Specificity
Specificity of human FCRL1/FcRH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCRL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCRL1/FcRH1 Protein (NBP1-84703PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCRL1/FcRH1 Antibody

  • BXMH1
  • CD307a antigen
  • CD307a
  • Fc receptor homolog 1
  • Fc receptor-like 1
  • FcRH1
  • FCRH1DKFZp667O1421
  • FCRL1
  • FcR-like protein 1
  • hIFGP1
  • IFGP family protein 1
  • IFGP1
  • IFGP1Fc receptor-like protein 1
  • Immune receptor translocation-associated protein 5
  • IRTA5
  • IRTA5immunoglobulin superfamily Fc receptor, gp42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2048
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2426
Species: Hu
Applications: WB, IHC
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
MAB7905
Species: Mu
Applications: WB, Flow, CyTOF-ready
MAB356
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
AF4705
Species: Hu
Applications: WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF4330
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62627
Species: Hu
Applications: IHC, IHC-P

Publications for FCRL1/FcRH1 Antibody (NBP1-84703) (0)

There are no publications for FCRL1/FcRH1 Antibody (NBP1-84703).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRL1/FcRH1 Antibody (NBP1-84703) (0)

There are no reviews for FCRL1/FcRH1 Antibody (NBP1-84703). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FCRL1/FcRH1 Antibody (NBP1-84703) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCRL1/FcRH1 Products

Bioinformatics Tool for FCRL1/FcRH1 Antibody (NBP1-84703)

Discover related pathways, diseases and genes to FCRL1/FcRH1 Antibody (NBP1-84703). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRL1/FcRH1 Antibody (NBP1-84703)

Discover more about diseases related to FCRL1/FcRH1 Antibody (NBP1-84703).
 

Pathways for FCRL1/FcRH1 Antibody (NBP1-84703)

View related products by pathway.

Blogs on FCRL1/FcRH1

There are no specific blogs for FCRL1/FcRH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCRL1/FcRH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCRL1
Entrez