FCP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FCP1 Antibody [NBP1-84704] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: FCP1 Antibody [NBP1-84704] Staining of human cerebral cortex shows strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: FCP1 Antibody [NBP1-84704] - Staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

FCP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRNRKLVLMVDLDQTLIHTTEQHCQQMSNK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTDP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
FCP1 Protein (NBP1-84704PEP)

Alternate Names for FCP1 Antibody

  • CCFDN
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase
  • CTD of POLR2A, phosphatase of, subunit 1
  • EC 3.1.3.16
  • FCP1TFIIF-associating CTD phosphatase 1
  • RNA polymerase II subunit A C-terminal domain phosphatase
  • serine phosphatase FCP1a
  • subunit 1
  • TFIIF-associating CTD phosphatase
  • transcription factor IIF-associating CTD phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-19596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30407
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-92311
Species: Hu
Applications: IHC, IHC-P
NBP1-48272
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-71822
Species: Hu, Mu(-)
Applications: WB, IP
NBP1-84704
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FCP1 Antibody (NBP1-84704) (0)

There are no publications for FCP1 Antibody (NBP1-84704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCP1 Antibody (NBP1-84704) (0)

There are no reviews for FCP1 Antibody (NBP1-84704). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FCP1 Antibody (NBP1-84704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCP1 Antibody Products

Related Products by Gene

Bioinformatics Tool for FCP1 Antibody (NBP1-84704)

Discover related pathways, diseases and genes to FCP1 Antibody (NBP1-84704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCP1 Antibody (NBP1-84704)

Discover more about diseases related to FCP1 Antibody (NBP1-84704).
 

Pathways for FCP1 Antibody (NBP1-84704)

View related products by pathway.

PTMs for FCP1 Antibody (NBP1-84704)

Learn more about PTMs related to FCP1 Antibody (NBP1-84704).
 

Research Areas for FCP1 Antibody (NBP1-84704)

Find related products by research area.

Blogs on FCP1

There are no specific blogs for FCP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FCP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTDP1

Customers Who Bought This Also Bought