FCHO2 Antibody


Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P

Order Details

FCHO2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG
Specificity of human FCHO2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCHO2 Protein (NBP2-32694PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-32694 in the following applications:

Read Publication using NBP2-32694.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FCHO2 Antibody

  • FCH domain only 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC

Publications for FCHO2 Antibody (NBP2-32694)(1)

Review for FCHO2 Antibody (NBP2-32694) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-32694:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot FCHO2 NBP2-32694
reviewed by:
WB Human 01/16/2015


ApplicationWestern Blot
Sample Testedhuman haploid HAP1 cell whole cell lysates


Blocking DetailsTBST + 5% non-fat milk, overnight at room temperature

Primary Anitbody

Dilution Ratio1:750 dilution in TBST + 1% milk. 2 hours at room temperature

Secondary Antibody

Secondary DescriptionDonkey ECL anti-rabbit IgG-HRP conjugate
Secondary Manufacturer Cat#NA934V (GE)
Secondary Concentration1:5,000 dilution


Detection NotesDenville Scientific HyGLO ECL. X-ray film, 30 second exposure. HAP1 positive control, FCHO2 gene-edited HAP1 cells negative cont


CommentsThere are several really lousy anti-FCHO2 antibodies out there. If you need one for immunoblotting, this antigen affinity-purified antibody is fabulous!

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCHO2 Antibody (NBP2-32694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FCHO2 Products

FCHO2 NBP2-32694

Bioinformatics Tool for FCHO2 Antibody (NBP2-32694)

Discover related pathways, diseases and genes to FCHO2 Antibody (NBP2-32694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCHO2 Antibody (NBP2-32694)

Discover more about diseases related to FCHO2 Antibody (NBP2-32694).

Pathways for FCHO2 Antibody (NBP2-32694)

View related products by pathway.

Blogs on FCHO2

There are no specific blogs for FCHO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol FCHO2