FCHO2 Antibody

Images

 
Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCHO2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCHO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:20
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FCHO2 Protein (NBP2-32694PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-32694 in the following applications:

Publications
Read Publication using NBP2-32694.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCHO2 Antibody

  • FCH domain only 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16458
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for FCHO2 Antibody (NBP2-32694)(1)

Review for FCHO2 Antibody (NBP2-32694) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP2-32694:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FCHO2 NBP2-32694
Enlarge
reviewed by:
Anonymous
WB Human 01/16/2015
View

Summary

ApplicationWestern Blot
Sample Testedhuman haploid HAP1 cell whole cell lysates
SpeciesHuman
LotR34486

Blocking

Blocking DetailsTBST + 5% non-fat milk, overnight at room temperature

Primary Anitbody

Dilution Ratio1:750 dilution in TBST + 1% milk. 2 hours at room temperature

Secondary Antibody

Secondary DescriptionDonkey ECL anti-rabbit IgG-HRP conjugate
Secondary Manufacturer Cat#NA934V (GE)
Secondary Concentration1:5,000 dilution

Details

Detection NotesDenville Scientific HyGLO ECL. X-ray film, 30 second exposure. HAP1 positive control, FCHO2 gene-edited HAP1 cells negative cont

Comments

CommentsThere are several really lousy anti-FCHO2 antibodies out there. If you need one for immunoblotting, this antigen affinity-purified antibody is fabulous!

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCHO2 Antibody (NBP2-32694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCHO2 Products

FCHO2 NBP2-32694

Bioinformatics Tool for FCHO2 Antibody (NBP2-32694)

Discover related pathways, diseases and genes to FCHO2 Antibody (NBP2-32694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCHO2 Antibody (NBP2-32694)

Discover more about diseases related to FCHO2 Antibody (NBP2-32694).
 

Pathways for FCHO2 Antibody (NBP2-32694)

View related products by pathway.

Blogs on FCHO2

There are no specific blogs for FCHO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/16/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol FCHO2