FCHO2 Antibody - BSA Free

Western Blot: FCHO2 Antibody [NBP2-32694] - HAP1 cells probed with anti-FCHO2 antibody (upper panel) or anti-ARH (LDLRAP1) antibody (lower panel). Image from a verified customer review.

Western Blot: FCHO2 Antibody [NBP2-32694] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human lymph node shows weak to moderate cytoplasmic positivity in non - germinal center cells.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human colon.

Immunohistochemistry-Paraffin: FCHO2 Antibody [NBP2-32694] - Staining of human testis.

Simple Western: FCHO2 Antibody [NBP2-32694] - Simple Western lane view shows a specific band for FCHO2 in 0.2 mg/ml of RT-4 (left), A431 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: FCHO2 Antibody [NBP2-32694] - Electropherogram image(s) of corresponding Simple Western lane view. FCHO2 antibody was used at 1:20 dilution on RT-4 and A431 lysate(s).

Western Blot: FCHO2 Antibody [NBP2-32694] - TALEN-mediated generation of FCHO1, FCHO2 and EPS15R triple-null HeLa cells. SDS-PAGE and immunoblot analysis of TALEN clones. Whole cell lysates subjected to SDS-PAGE were either stained with Coomassie blue or immunoblotted with the indicated antibodies. Molecular mass standards (in kDa) are shown on the left. Image collected and cropped by CiteAb from the following publication (//elifesciences.org/articles/41768), licensed under a CC-BY license.

Staining of human endometrium, kidney, placenta and skeletal muscle using NBP2-32694 (A) shows similar protein distribution across tissues to independent antibody NBP1-90904 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FCHO2 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit FCHO2 Antibody - BSA Free (NBP2-32694) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-FCHO2 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIG
• Predicted Species: Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCHO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 , A431, separated by Size, antibody dilution of 1:20, apparent MW was 117 kDa.
• Control Peptide:

  FCHO2 Protein (NBP2-32694PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCHO2 Antibody - BSA Free

• FCH domain only 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FCHO2 Antibody (NBP2-32694)(4)

Publications using NBP2-32694

• Zaccai NR, Kadlecova Z, Dickson VK et al. FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P2-dependent switch Science advances 2022-04-29 [PMID: 35486718] (WB)
• Wang X, Chen Z, Mettlen M et al. DASC, a sensitive classifier for measuring discrete early stages in clathrin-mediated endocytosis Elife 2020-04-30 [PMID: 32352376] (WB)
• Zhao X, Hu X A nanobody-based molecular toolkit provides new mechanistic insight into clathrin-coat initiation Elife 2019-04-30 [PMID: 31038455] (WB)
• Sochacki KA, Dickey AM, Strub MP, Taraska JW. Endocytic proteins are partitioned at the edge of the clathrin lattice in mammalian cells. Nat. Cell Biol. 2017-04-01 [PMID: 28346440]

Review for FCHO2 Antibody (NBP2-32694) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 01/16/2015

Summary

• Application: Western Blot
• Sample Tested: human haploid HAP1 cell whole cell lysates
• Species: Human
• Lot: R34486

Bioinformatics

• Gene Symbol: FCHO2