SRGAP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SRGAP2 Antibody [NBP1-89013] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SRGAP2 Antibody [NBP1-89013] - Staining of human cerebral cortex shows nuclear positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRGAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SRGAP2 Protein (NBP1-89013PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGAP2 Antibody

  • FNBP2
  • Formin-binding protein 2
  • KIAA0456ARHGAP34formin binding protein 2
  • Rho GTPase-activating protein 34
  • SLIT-ROBO Rho GTPase activating protein 2
  • SLIT-ROBO Rho GTPase-activating protein 2
  • srGAP2
  • SRGAP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81479
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-88460
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89013
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SRGAP2 Antibody (NBP1-89013) (0)

There are no publications for SRGAP2 Antibody (NBP1-89013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGAP2 Antibody (NBP1-89013) (0)

There are no reviews for SRGAP2 Antibody (NBP1-89013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SRGAP2 Antibody (NBP1-89013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGAP2 Products

Bioinformatics Tool for SRGAP2 Antibody (NBP1-89013)

Discover related pathways, diseases and genes to SRGAP2 Antibody (NBP1-89013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGAP2 Antibody (NBP1-89013)

Discover more about diseases related to SRGAP2 Antibody (NBP1-89013).
 

Pathways for SRGAP2 Antibody (NBP1-89013)

View related products by pathway.

PTMs for SRGAP2 Antibody (NBP1-89013)

Learn more about PTMs related to SRGAP2 Antibody (NBP1-89013).

Blogs on SRGAP2

There are no specific blogs for SRGAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGAP2