Fc epsilon RI Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FCER1A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Fc epsilon RI Antibody - BSA Free
Background
The allergic reaction is mediated through the IgE high affinity receptor (FceRI). When a multivalent antigen is presented, a redistribution of the monomeric IgE FceRI receptor complexes cause the degranulation of mast cells and basophils, resulting in the subsequent release of factors responsible for the allergic reaction. The FceRI receptor is a tetrameric complex, consisting of a a-chain, b-chain and a dimeric g-chain. While the a-chain is primarily involved with the binding of IgE, the signal is transferred through the g subunit, which contains the immunoreceptor tyrosine activation motifs (ITAM) critical for initiating receptor mediated signal transduction through the Syk and Lyn tyrosine kinases. The FceRI receptor is able to engage and disengage the IgE, providing a versatile model for studying the function of kinase coupled receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Publications for Fc epsilon RI Antibody (NBP2-54974) (0)
There are no publications for Fc epsilon RI Antibody (NBP2-54974).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fc epsilon RI Antibody (NBP2-54974) (0)
There are no reviews for Fc epsilon RI Antibody (NBP2-54974).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Fc epsilon RI Antibody (NBP2-54974) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fc epsilon RI Products
Research Areas for Fc epsilon RI Antibody (NBP2-54974)
Find related products by research area.
|
Blogs on Fc epsilon RI