Fc epsilon RI Antibody

Images

 
Immunohistochemistry-Paraffin: Fc epsilon RI Antibody [NBP2-54974] - Staining of human lymph node shows strong cytoplasmic positivity in a rare number of non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fc epsilon RI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL
Specificity
Specificity of human Fc epsilon RI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCER1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Fc epsilon RI Antibody

  • alpha polypeptide
  • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
  • Fc-epsilon RI-alpha
  • FcERI
  • high affinity immunoglobulin epsilon receptor alpha-subunit
  • high affinity immunoglobulin epsilon receptor subunit alpha
  • high-affinity, of mast cells, alpha polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NB100-56722
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NBP1-47492
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
8415-A2
Species: Mu
NBP1-85959
Species: Hu
Applications: IHC, IHC-P
AF123
Species: Hu
Applications: WB, Block, ICC

Publications for Fc epsilon RI Antibody (NBP2-54974) (0)

There are no publications for Fc epsilon RI Antibody (NBP2-54974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI Antibody (NBP2-54974) (0)

There are no reviews for Fc epsilon RI Antibody (NBP2-54974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fc epsilon RI Antibody (NBP2-54974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fc epsilon RI Products

Bioinformatics Tool for Fc epsilon RI Antibody (NBP2-54974)

Discover related pathways, diseases and genes to Fc epsilon RI Antibody (NBP2-54974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc epsilon RI Antibody (NBP2-54974)

Discover more about diseases related to Fc epsilon RI Antibody (NBP2-54974).
 

Pathways for Fc epsilon RI Antibody (NBP2-54974)

View related products by pathway.

PTMs for Fc epsilon RI Antibody (NBP2-54974)

Learn more about PTMs related to Fc epsilon RI Antibody (NBP2-54974).
 

Research Areas for Fc epsilon RI Antibody (NBP2-54974)

Find related products by research area.

Blogs on Fc epsilon RI

There are no specific blogs for Fc epsilon RI, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc epsilon RI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER1A