FBXW8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXW8 Antibody [NBP1-84715] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXW8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXW8 Protein (NBP1-84715PEP)
Publications
Read Publications using
NBP1-84715 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25790475).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXW8 Antibody

  • F-box and WD repeat domain containing 8
  • F-box only protein 29F-box/WD repeat-containing protein 8
  • FBW8F-box and WD-40 domain-containing protein 8
  • FBX29MGC33534
  • FBXO29
  • FBXW6FBW6F-box and WD-40 domain protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78042
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16450
Species: Hu
Applications: WB, ICC/IF
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC

Publications for FBXW8 Antibody (NBP1-84715)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FBXW8 Antibody (NBP1-84715) (0)

There are no reviews for FBXW8 Antibody (NBP1-84715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXW8 Antibody (NBP1-84715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXW8 Products

Bioinformatics Tool for FBXW8 Antibody (NBP1-84715)

Discover related pathways, diseases and genes to FBXW8 Antibody (NBP1-84715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW8 Antibody (NBP1-84715)

Discover more about diseases related to FBXW8 Antibody (NBP1-84715).
 

Pathways for FBXW8 Antibody (NBP1-84715)

View related products by pathway.

PTMs for FBXW8 Antibody (NBP1-84715)

Learn more about PTMs related to FBXW8 Antibody (NBP1-84715).

Blogs on FBXW8

There are no specific blogs for FBXW8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW8