FBXW8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FBXW8 Antibody [NBP1-84715] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining of human thyroid gland shows high expression.
Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining in human thyroid gland and skeletal muscle tissues using anti-FBXW8 antibody. Corresponding FBXW8 RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FBXW8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXW8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC, WB reported in the scientific literature (PMID: 25790475).
Control Peptide
FBXW8 Protein (NBP1-84715PEP)
Publications
Read Publications using
NBP1-84715 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25790475).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXW8 Antibody

  • F-box and WD repeat domain containing 8
  • F-box only protein 29F-box/WD repeat-containing protein 8
  • FBW8F-box and WD-40 domain-containing protein 8
  • FBX29MGC33534
  • FBXO29
  • FBXW6FBW6F-box and WD-40 domain protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78042
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, NULL, WB
NBP2-75458
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, IP, WB
NBP2-75643
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
255-SC/CF
Species: Hu
Applications: BA
NBP1-52158
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-59631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-16669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61712
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB

Publications for FBXW8 Antibody (NBP1-84715)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FBXW8 Antibody (NBP1-84715) (0)

There are no reviews for FBXW8 Antibody (NBP1-84715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXW8 Antibody (NBP1-84715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXW8 Products

Bioinformatics Tool for FBXW8 Antibody (NBP1-84715)

Discover related pathways, diseases and genes to FBXW8 Antibody (NBP1-84715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXW8 Antibody (NBP1-84715)

Discover more about diseases related to FBXW8 Antibody (NBP1-84715).
 

Pathways for FBXW8 Antibody (NBP1-84715)

View related products by pathway.

PTMs for FBXW8 Antibody (NBP1-84715)

Learn more about PTMs related to FBXW8 Antibody (NBP1-84715).

Blogs on FBXW8

There are no specific blogs for FBXW8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXW8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXW8