FBG4 Antibody - BSA Free

Western Blot: FBG4 Antibody [NBP2-86629] - Host: Rabbit. Target Name: FBXO17. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FBG4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FBG4 Antibody - BSA Free (NBP2-86629) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBG4. Peptide sequence: VQVLSHVPPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FBG4 Antibody - BSA Free

• FBG4FBXO26
• F-box only protein 17
• F-box protein 17
• F-box protein FBG4
• FBX17
• FBX26F-box only protein 26
• FLJ11798
• FLJ25205
• FLJ58300
• MGC9379

Background

F-box proteins, a critical component of the evolutionary conserved ubiquitin-protein ligase complex SCF (Skp1/Cdc53-Cullin1/F-box), recruit substrates for ubiquitination and consequent degradation through their specific protein-protein interaction domains. Novel human F-box proteins named FBG1, FBG2, FBG3, FBG4 and FBG5 constitute a third subfamily of mammalian F-box proteins. FBG genes are expressed in a limited number of human tissues including kidney, liver, brain and muscle tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FBXO17