FBXO44 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FBXO44 Antibody [NBP1-84728] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FBXO44 Antibody [NBP1-84728] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: FBXO44 Antibody [NBP1-84728] - Staining of human brain shows strong nuclear and cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FBXO44 Antibody [NBP1-84728] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: FBXO44 Antibody [NBP1-84728] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Analysis in human cell line SK-MEL-30.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBXO44 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FBXO44 Antibody - BSA Free (NBP1-84728) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FBXO44 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXO44
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FBXO44 Recombinant Protein Antigen (NBP1-84728PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXO44 Antibody - BSA Free

• FBG3 DKFZp781J0852
• F-box gene 3
• F-box only protein 44
• F-box protein 44
• F-box protein FBX30
• F-box/G-domain protein 3
• FBX30FBX6AFbx44
• FBX44
• Fbxo6a
• MGC14140

Background

F-box proteins, a critical component of the evolutionary conserved ubiquitin-protein ligase complex SCF (Skp1/Cdc53-Cullin1/F-box), recruit substrates for ubiquitination and consequent degradation through their specific protein-protein interaction domains. Novel human F-box proteins named FBG1, FBG2, FBG3, FBG4 and FBG5 constitute a third subfamily of mammalian F-box proteins. FBG genes are expressed in a limited number of human tissues including kidney, liver, brain and muscle tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXO44 Antibody (NBP1-84728)(2)

Publications using NBP1-84728

• Sjogren B, Swaney S, Neubig RR. FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex. PLoS One 2015-01-01 [PMID: 25970626] (WB, Human)
• Lu Y, Li J, Cheng D et al. The F-box Protein FBXO44 Mediates BRCA1 Ubiquitination and Degradation. J Biol Chem 2012-11-30 [PMID: 23086937]

Bioinformatics

• Gene Symbol: FBXO44