FBXO44 Antibody

Images

 
Western Blot: FBXO44 Antibody [NBP1-84728] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: FBXO44 Antibody [NBP1-84728] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FBXO44 Antibody [NBP1-84728] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVRSQARLRVQVPAVRSAPVVRARASGDLPARPGDHPAEERCQVEGGLPHILQLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO44
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXO44 Recombinant Protein Antigen (NBP1-84728PEP)
Publications
Read Publications using
NBP1-84728 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%). Reactivity reported in scientific literature (PMID: 23086937)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXO44 Antibody

  • FBG3 DKFZp781J0852
  • F-box gene 3
  • F-box only protein 44
  • F-box protein 44
  • F-box protein FBX30
  • F-box/G-domain protein 3
  • FBX30FBX6AFbx44
  • FBX44
  • Fbxo6a
  • MGC14140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55140
Species: Hu
Applications: ICC/IF
NBP2-16451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-466
Species: Hu, Mu, Rt
Applications: WB
NB100-93569
Species: Hu, Mu, Rt
Applications: WB
NBP1-55046
Species: Hu
Applications: WB
NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-57960
Species: Hu
Applications: ICC/IF
AF8355
Species: Hu
Applications: WB, IHC
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-88219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for FBXO44 Antibody (NBP1-84728)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FBXO44 Antibody (NBP1-84728) (0)

There are no reviews for FBXO44 Antibody (NBP1-84728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXO44 Antibody (NBP1-84728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO44 Products

Bioinformatics Tool for FBXO44 Antibody (NBP1-84728)

Discover related pathways, diseases and genes to FBXO44 Antibody (NBP1-84728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO44 Antibody (NBP1-84728)

Discover more about diseases related to FBXO44 Antibody (NBP1-84728).
 

Pathways for FBXO44 Antibody (NBP1-84728)

View related products by pathway.

PTMs for FBXO44 Antibody (NBP1-84728)

Learn more about PTMs related to FBXO44 Antibody (NBP1-84728).

Blogs on FBXO44

There are no specific blogs for FBXO44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO44