Recombinant Human FBXO27 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXO27 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 283 of Human FBXO27 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FBXO27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXO27 GST (N-Term) Protein

  • Fbg5
  • FBG5FBX27
  • F-box only protein 27
  • F-box protein 27
  • F-box protein FBG5
  • F-box/G-domain protein 5
  • Fbx27

Background

Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00026232-B01P
Species: Hu, Rt
Applications: WB
NBP3-15332
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-466
Species: Hu, Mu, Rt
Applications: WB
255-SC/CF
Species: Hu
Applications: BA
NBP1-84728
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55046
Species: Hu
Applications: WB
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NB100-1591
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-75643
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for FBXO27 Recombinant Protein (H00126433-P01) (0)

There are no publications for FBXO27 Recombinant Protein (H00126433-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO27 Recombinant Protein (H00126433-P01) (0)

There are no reviews for FBXO27 Recombinant Protein (H00126433-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO27 Recombinant Protein (H00126433-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXO27 Products

Bioinformatics Tool for FBXO27 Recombinant Protein (H00126433-P01)

Discover related pathways, diseases and genes to FBXO27 Recombinant Protein (H00126433-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FBXO27 Recombinant Protein (H00126433-P01)

View related products by pathway.

Blogs on FBXO27

There are no specific blogs for FBXO27, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXO27 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO27