SLC35D3 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human upper gastrointestinal shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: SLC35D3 Antibody [NBP1-81867] - Staining of human salivary gland shows moderate to strong granular cytoplasmic positivity in ductal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC35D3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM
Specificity
Specificity of human SLC35D3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC35D3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC35D3 Antibody

  • bA55K22.3
  • frc, fringe-like 1
  • FRCL1
  • Fringe connection-like protein 1
  • MGC102873
  • solute carrier family 35 member D3
  • solute carrier family 35, member D3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85889
Species: Hu
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-66906
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00148641-P01
Species: Hu
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80089
Species: Hu
Applications: WB
NBP2-13333
Species: Hu
Applications: WB, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-57757
Species: Hu
Applications: IHC, IHC-P
H00004016-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC, IHC-P
NBP1-88644
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47404
Species: Hu
Applications: IHC, IHC-P
H00002300-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58768
Species: Hu
Applications: ICC/IF
AF7105
Species: Hu
Applications: WB
NBP1-81867
Species: Hu
Applications: IHC, IHC-P

Publications for SLC35D3 Antibody (NBP1-81867) (0)

There are no publications for SLC35D3 Antibody (NBP1-81867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC35D3 Antibody (NBP1-81867) (0)

There are no reviews for SLC35D3 Antibody (NBP1-81867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC35D3 Antibody (NBP1-81867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC35D3 Products

Bioinformatics Tool for SLC35D3 Antibody (NBP1-81867)

Discover related pathways, diseases and genes to SLC35D3 Antibody (NBP1-81867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC35D3 Antibody (NBP1-81867)

Discover more about diseases related to SLC35D3 Antibody (NBP1-81867).
 

Pathways for SLC35D3 Antibody (NBP1-81867)

View related products by pathway.

PTMs for SLC35D3 Antibody (NBP1-81867)

Learn more about PTMs related to SLC35D3 Antibody (NBP1-81867).

Blogs on SLC35D3

There are no specific blogs for SLC35D3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC35D3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC35D3
COVID-19 update