FBF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FBF1 Antibody [NBP1-90863] - Immunofluorescent staining of human cell line A549 shows localization to centrosome.

Immunohistochemistry-Paraffin: FBF1 Antibody [NBP1-90863] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry: FBF1 Antibody [NBP1-90863] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: FBF1 Antibody [NBP1-90863] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: FBF1 Antibody [NBP1-90863] - Staining of human fallopian tube shows weak membranous positivity in glandular cells.

Staining of human cell line A549 shows localization to centrosome.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FBF1 Antibody - BSA Free (NBP1-90863) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FBF1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ARTKSLLGDDVFSTMAGLEEADAEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FBF1 Protein (NBP1-90863PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24285713)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBF1 Antibody - BSA Free

• Alb
• albatross
• Fas (TNFRSF6) binding factor 1
• Fas binding protein 1
• fas-binding factor 1
• FBF-1
• FLJ00103
• FLJ13996
• KIAA1863
• protein albatross

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBF1 Antibody (NBP1-90863)(3)

Publications using NBP1-90863

• Kong D, Farmer V, Shukla A et al. Centriole maturation requires regulated Plk1 activity during two consecutive cell cycles. J Cell Biol 2014-09-29 [PMID: 25246616] (IF/IHC)
• Jodoin JN, Shboul M, Albrecht TR et al. The snRNA-processing complex, Integrator, is required for ciliogenesis and dynein recruitment to the nuclear envelope via distinct mechanisms. Biol Open 2013-12-15 [PMID: 24285713]
• Jakobsen L, Vanselow K, Skogs M et al. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. EMBO J 2011-04-01 [PMID: 21399614]

Bioinformatics

• Gene Symbol: FBF1