Fast skeletal myosin light chain 1 Antibody

Images

 
Western Blot: Fast skeletal myosin light chain 1 Antibody [H00004632-B01P] - Analysis of MYL1 expression in transfected 293T cell line by MYL1 polyclonal antibody. Lane 1: MYL1 transfected lysate(21.34 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fast skeletal myosin light chain 1 Antibody Summary

Immunogen
MYL1 (NP_524144.1, 1 a.a. - 194 a.a.) full-length human protein. MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MYL1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fast skeletal myosin light chain 1 Antibody

  • A1 catalytic
  • A2 catalytic
  • MLC1/MLC3
  • MLC1F
  • MLC1F/MLC3F
  • MLC3F
  • myosin light chain 1/3, skeletal muscle isoform
  • Myosin light chain A1/A2
  • Myosin light chain alkali 1/2
  • myosin, light chain 1, alkali; skeletal, fast
  • myosin, light polypeptide 1, alkali; skeletal, fast

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MAB5018
Species: Hu
Applications: WB, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P) (0)

There are no publications for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P) (0)

There are no reviews for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fast skeletal myosin light chain 1 Products

Bioinformatics Tool for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P)

Discover related pathways, diseases and genes to Fast skeletal myosin light chain 1 Antibody (H00004632-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P)

Discover more about diseases related to Fast skeletal myosin light chain 1 Antibody (H00004632-B01P).
 

Pathways for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P)

View related products by pathway.

PTMs for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P)

Learn more about PTMs related to Fast skeletal myosin light chain 1 Antibody (H00004632-B01P).
 

Research Areas for Fast skeletal myosin light chain 1 Antibody (H00004632-B01P)

Find related products by research area.

Blogs on Fast skeletal myosin light chain 1

There are no specific blogs for Fast skeletal myosin light chain 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fast skeletal myosin light chain 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL1
Uniprot