FANCM Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FANCM Antibody [NBP2-55444] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FANCM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH
Specificity
Specificity of human FANCM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FANCM
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FANCM Antibody

  • ATP-dependent RNA helicase FANCM
  • EC 3.6.1
  • FAAP250EC 3.6.4.13
  • Fanconi anemia, complementation group M
  • Fanconi anemia-associated polypeptide of 250 kDa
  • KIAA1596Fanconi anemia group M protein
  • MGC176453
  • Protein FACM
  • Protein Hef ortholog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-182
Species: Hu, Mu, Rt, Ca, Kg, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-91876
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65632
Species: Hu
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
21340002
Species: Hu
Applications: WB, ELISA
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00002188-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-214
Species: Hu, Mu
Applications: WB, IP
NB100-2566
Species: Hu
Applications: WB, IB
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP2-55444
Species: Hu
Applications: ICC/IF

Publications for FANCM Antibody (NBP2-55444) (0)

There are no publications for FANCM Antibody (NBP2-55444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCM Antibody (NBP2-55444) (0)

There are no reviews for FANCM Antibody (NBP2-55444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FANCM Antibody (NBP2-55444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FANCM Products

Bioinformatics Tool for FANCM Antibody (NBP2-55444)

Discover related pathways, diseases and genes to FANCM Antibody (NBP2-55444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCM Antibody (NBP2-55444)

Discover more about diseases related to FANCM Antibody (NBP2-55444).
 

Pathways for FANCM Antibody (NBP2-55444)

View related products by pathway.

PTMs for FANCM Antibody (NBP2-55444)

Learn more about PTMs related to FANCM Antibody (NBP2-55444).

Blogs on FANCM.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCM