FANCF Recombinant Protein Antigen

Images

 
There are currently no images for FANCF Recombinant Protein Antigen (NBP3-17845PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FANCF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCF

Source: E. coli

Amino Acid Sequence: GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FANCF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17845.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FANCF Recombinant Protein Antigen

  • FAF
  • Fanconi anemia group F protein
  • Fanconi anemia, complementation group F
  • MGC126856
  • Protein FACF

Background

FANCF (also called Protein FACF or Fanconi Anemia Group F protein) is involved in DNA repair, perhaps specifically with post-replication repair or a cell cycle checkpoint function. FANCF has also been implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. FANCF belongs to the multi-subunit Fanconi Anemia (FA) complex composed of FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9 and FANCM. The complex is not found in FA patients. FANCF is found within the nucleus. Defects in FANCF are a cause of Fanconi anemia (FA). FA is a genetically heterogeneous, autosomal recessive disorder characterized by progressive pancytopaenia, a diverse assortment of congenital malformations, and a predisposition to the development of malignancies. At the cellular level, it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage), and defective DNA repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2564
Species: Hu
Applications: WB
NB100-2566
Species: Hu
Applications: IB, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
H00002176-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB8170
Species: Hu, Mu, Rt
Applications: IHC, KO, mIF, Simple Western, WB
NBP1-49878
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-48321
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84758
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for FANCF Recombinant Protein Antigen (NBP3-17845PEP) (0)

There are no publications for FANCF Recombinant Protein Antigen (NBP3-17845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCF Recombinant Protein Antigen (NBP3-17845PEP) (0)

There are no reviews for FANCF Recombinant Protein Antigen (NBP3-17845PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FANCF Recombinant Protein Antigen (NBP3-17845PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCF Products

Blogs on FANCF.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FANCF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCF