Home » FANCB » FANCB Antibodies » FANCB Antibody (2B10)

FANCB Antibody (2B10)

 Submit a Review

Images

 
(
Enlarge)
ELISA: FANCB Antibody (2B10) [H00002187-M01] - Detection limit for recombinant GST tagged FANCB is 3 ng/ml as a capture antibody.
ELISA: FANCB Antibody (2B10) [H00002187-M01] - Detection limit for recombinant GST tagged FANCB is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FANCB Antibody (2B10) Summary

Immunogen
FANCB (NP_689846.1, 750 a.a. ~ 858 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCEVSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLKVSGALYREITLKVAEVQLKSDFAAQKLSN
Specificity
FANCB - Fanconi anemia, complementation group B (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FANCB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FANCB Antibody (2B10)

  • EC 2.8.1
  • EC 3.6.3.14
  • FA2
  • FAAP90
  • FAAP95FAB
  • FACB
  • Fanconi anemia group B protein
  • Fanconi anemia, complementation group B
  • Fanconi anemia-associated polypeptide of 95 kDa
  • FLJ34064
  • Protein FACB

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASXL1 Antibody
(6E2)
H00171023-M05
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Functional effects of CRISPR/Cas9-mediated ASXL1 mutation correction. Evaluation of ASXL1 protein expression by Western blotting. Left-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, the K562 leukemia cell line (carrying the Y591X heterozygous ASXL1 mutation), and KBM5 clones (labeled 1-5) with heterozygous precise correction of the ASXL1 mutation. Right-hand side: ASXL1 protein expression in the SET2 leukemia cell line (wild-type for ASXL1), uncorrected KBM5 cells, and KBM5 clones (labeled 1-5) with homozygous precise correction of the ASXL1 mutation. Beta-actin was used as loading control. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/6392) licensed under a CC-BY licence.
Western Blot: ASXL1 Antibody (6E2) [H00171023-M05] - Analysis of ASXL1 expression in MCF-7 (Cat # L046V1).
ELISA: ASXL1 Antibody (6E2) [H00171023-M05] - Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
LIS1 Antibody
NBP1-87769
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human liver shows no positivity in hepatocytes as expected.
(2 Reviews)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
14-3-3 epsilon
Antibody
NBP1-89827
Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: 14-3-3 epsilon Antibody [NBP1-89827] - Staining 14-3-3 epsilon in methanol-fixed, rat primary motor neurons using anti-14-3-3 epsilon antibody (green). Nuclei were stained with DAPI (blue). Image from verified customer review.
Immunohistochemistry-Paraffin: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SAP155 Antibody
(JB40-32)
NBP2-75656
Western Blot: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of SF3B1 on different lysates using anti-SF3B1 antibody at 1/500 dilution.Positive control:Lane 1: Mouse thymus Lane 2: Hela
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded rat brain tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: SAP155 Antibody (JB40-32) [NBP2-75656] - Analysis of paraffin-embedded human colon cancer tissue using anti-SF3B1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(21 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Siglec-3/CD33
Antibody (44M12D3)
NBP2-22377
Western Blot: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Analysis of CD33 in A) a partial recombinant protein and B) HCT-116 lysate using CD33 antibody at 2 ug/ml. goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Siglec-3/CD33 Antibody (44M12D3) [NBP2-22377] - Human lung tissue stained with CD33 antibody (3 ug/ml), peroxidase-conjugate and DAB chromogen. Note cytoplasmic and membrane staining.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P

Myeloperoxidase/MPO An ...
AF3667
Western blot shows lysates of HL‑60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of mouse spleen tissue, loaded at 0.2 mg/mL. A specific band was detected for Myeloperoxidase/MPO at approximately 67 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Myeloperoxidase/MPO was detected in immersion fixed mouse splenocytes using Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(5 Reviews)
(29 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Aminopeptidase N/CD13 was detected in immersion fixed mouse splenocytes using Goat Anti-Mouse Aminopeptidase N/CD13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2335) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Aminopeptidase N/CD13 was detected in immersion fixed paraffin-embedded sections of mouse kidney using Goat Anti-Mouse Aminopeptidase N/CD13 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2335) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to apical membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(14 Publications)
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
EMMPRIN/CD147
Antibody [Unconjugate
AF972
Western blot shows lysates of human brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EMMPRIN/CD147 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF972) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EMMPRIN/CD147 at approximately38-50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EMMPRIN/CD147 was detected in immersion fixed paraffin-embedded sections of human cervix using Goat Anti-Human EMMPRIN/CD147 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF972) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membranes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and EMMPRIN/CD147 knockout HEK293T cell line (KO). PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EMMPRIN/CD147 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF972) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EMMPRIN/CD147 at approximately 51 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(8 Publications)
Species: Hu
Applications: WB, Simple Western, ELISA, IHC, KO
TdT Antibody
NBP2-31368
Western Blot: TdT Antibody [NBP2-31368] - WB detection of TDT protein in (A) lysate of MOLT4 human leukemia cell line and (B) partial recombinant protein by using TDT antibody. Primary antibody concentration used: 1 ug/ml for Molt4 lysate, 0.05 ug/ml for recombinant protein.
Immunocytochemistry/Immunofluorescence: TdT Antibody [NBP2-31368] - TdT antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody concentration of 0.01 ug/ml was used. Image objective 40x.
Immunohistochemistry-Paraffin: TdT Antibody [NBP2-31368] - IHC-P analysis of TdT protein in a section of human hepatocellular carcinoma (HCC) using TdT antibody at a concentration of 10 ug/ml. The HCC cells depicted strong nuclear / weak cytoplasmic positivity for TdT immunostaining.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Invadolysin
Antibody
NBP1-92025
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: Invadolysin Antibody [NBP1-92025] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Invadolysin Antibody [NBP1-92025] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
Inversin GST (N-Term) ...
H00027130-P02
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
CD7 Antibody
AF7579
Western blot shows lysates of MOLT‑4 human acute lymphoblastic leukemia cell line, HepG2 human hepatocellular carcinoma cell line, and human peripheral blood lymphocytes (PBL). PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human CD7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7579) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD7 at approximately 35-40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Human peripheral blood mononuclear cells (PBMCs) were stained with Mouse Anti-Human CD3 epsilon APC-conjugated Monoclonal Antibody (Catalog # FAB100A) and either (A) Sheep Anti-Human CD7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7579) or (B) Sheep IgG Control (Catalog # 5-001-A) followed by Phycoerythrin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0126).
CD7 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Sheep Anti-Human CD7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7579) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
FANCB Antibody
(2B10)
H00002187-M01
FANCB Antibody (2B10)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for FANCB Antibody (H00002187-M01) (0)

There are no publications for FANCB Antibody (H00002187-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCB Antibody (H00002187-M01) (0)

There are no reviews for FANCB Antibody (H00002187-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANCB Antibody (H00002187-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FANCB Products

Bioinformatics Tool for FANCB Antibody (H00002187-M01)

Discover related pathways, diseases and genes to FANCB Antibody (H00002187-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCB Antibody (H00002187-M01)

Discover more about diseases related to FANCB Antibody (H00002187-M01).
 

Pathways for FANCB Antibody (H00002187-M01)

View related products by pathway.

PTMs for FANCB Antibody (H00002187-M01)

Learn more about PTMs related to FANCB Antibody (H00002187-M01).

Blogs on FANCB.

Check out the latest blog posts on FANCB.
Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCB Antibody (2B10) and receive a gift card or discount.


Bioinformatics

Gene Symbol FANCB
Entrez
Uniprot