FANCB Antibody (2B10)

Images

 
ELISA: FANCB Antibody (2B10) [H00002187-M01] - Detection limit for recombinant GST tagged FANCB is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FANCB Antibody (2B10) Summary

Immunogen
FANCB (NP_689846.1, 750 a.a. ~ 858 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCEVSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLKVSGALYREITLKVAEVQLKSDFAAQKLSN
Specificity
FANCB - Fanconi anemia, complementation group B (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FANCB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FANCB Antibody (2B10)

  • EC 2.8.1
  • EC 3.6.3.14
  • FA2
  • FAAP90
  • FAAP95FAB
  • FACB
  • Fanconi anemia group B protein
  • Fanconi anemia, complementation group B
  • Fanconi anemia-associated polypeptide of 95 kDa
  • FLJ34064
  • Protein FACB

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00171023-M05
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
AF972
Species: Hu
Applications: WB, Simple Western, ELISA, IHC, KO
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002187-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for FANCB Antibody (H00002187-M01) (0)

There are no publications for FANCB Antibody (H00002187-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCB Antibody (H00002187-M01) (0)

There are no reviews for FANCB Antibody (H00002187-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANCB Antibody (H00002187-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FANCB Products

Bioinformatics Tool for FANCB Antibody (H00002187-M01)

Discover related pathways, diseases and genes to FANCB Antibody (H00002187-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCB Antibody (H00002187-M01)

Discover more about diseases related to FANCB Antibody (H00002187-M01).
 

Pathways for FANCB Antibody (H00002187-M01)

View related products by pathway.

PTMs for FANCB Antibody (H00002187-M01)

Learn more about PTMs related to FANCB Antibody (H00002187-M01).

Blogs on FANCB.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FANCB Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCB
Entrez
Uniprot