FAM64A Antibody

Product Discontinued

FAM64A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRL ETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM64A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM64A Antibody

• family with sequence similarity 64, member A
• FLJ10156
• FLJ10491
• RCS1
• regulator of chromosome segregation 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM64A