FAM62B Antibody

Images

 
Western Blot: FAM62B Antibody [NBP1-59988] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
Immunoprecipitation: FAM62B Antibody [NBP1-59988] - Titration: 1 ug/ml Positive Control: HEK-293T cells

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM62B Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM62B(family with sequence similarity 62 (C2 domain containing) member B) The peptide sequence was selected from the middle region of FAM62B. Peptide sequence NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ESYT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FAM62B and was validated on Western blot.
Publications
Read Publication using NBP1-59988.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM62B Antibody

  • Chr2Syt
  • E-Syt2
  • extended synaptotagmin-2
  • extended synaptotagmin-like protein 2
  • FAM62B
  • KIAA1228member B

Background

FAM62B may play a role as calcium-regulated intrinsic membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59988
Species: Hu
Applications: WB, IP

Publications for FAM62B Antibody (NBP1-59988)(1)

Reviews for FAM62B Antibody (NBP1-59988) (0)

There are no reviews for FAM62B Antibody (NBP1-59988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM62B Antibody (NBP1-59988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM62B Products

Bioinformatics Tool for FAM62B Antibody (NBP1-59988)

Discover related pathways, diseases and genes to FAM62B Antibody (NBP1-59988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM62B

There are no specific blogs for FAM62B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM62B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ESYT2