DBC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining in human testis and liver tissues using anti-CCAR2 antibody. Corresponding CCAR2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining of human kidney, liver, pancreas and testis using [NBP1-85304] (A) shows similar protein distribution across tissues to independent antibody NBP1-85305 (B).

Western Blot: DBC1 Antibody [NBP1-85304] - Analysis using [NBP1-85304] (A) shows similar pattern to independent antibody (NBP1-85305) (B).

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining of human pancreas.

Immunohistochemistry-Paraffin: DBC1 Antibody [NBP1-85304] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DBC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DBC1 Antibody - BSA Free (NBP1-85304) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
• Predicted Species: Mouse (95%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRINP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DBC1 Protein (NBP1-85304PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DBC1 Antibody - BSA Free

• DBCCR1deleted in bladder cancer protein 1
• deleted in bladder cancer 1
• deleted in bladder cancer chromosome region candidate 1
• FAM5AbA574M5.1 (deleted in bladder cancer chromosome region candidate 1 (IB3089A))
• Protein FAM5A

Background

The DBC1 gene is located within a chromosomal region that shows loss of heterozygosity in some bladder cancers. It containsa 5' CpG island that may be a frequent target of hypermethylation, and it may undergo hypermethylation-basedsilencing in some bladder ca

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRINP1