![Western Blot: FAM48A Antibody [NBP3-03767] - Analysis of extracts of various cell lines, using FAM48A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit](http://images.novusbio.com/fullsize/FAM48A-Antibody-Western-Blot-NBP3-03767-img0005.jpg "Western Blot: FAM48A Antibody [NBP3-03767] - Analysis of extracts of various cell lines, using FAM48A antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FAM48A Antibody - BSA Free (NBP3-03767) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 580-779 of human FAM48A (NP_001014308.2). NLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUPT20H |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FAM48A Antibody (NBP3-03767)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUPT20H |
![Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded mouse liver using FAM48A antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FAM48A-Antibody-Immunohistochemistry-Paraffin-NBP3-03767-img0004.jpg "Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded mouse liver using FAM48A antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded human colon using FAM48A antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FAM48A-Antibody-Immunohistochemistry-Paraffin-NBP3-03767-img0002.jpg "Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded human colon using FAM48A antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded human kidney using FAM48A antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/FAM48A-Antibody-Immunohistochemistry-Paraffin-NBP3-03767-img0003.jpg "Immunohistochemistry-Paraffin: FAM48A Antibody [NBP3-03767] - Paraffin-embedded human kidney using FAM48A antibody at dilution of 1:100 (40x lens).")
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![SDS-PAGE Complement Component C5a [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_2150-C5_638.jpg)
![Bioactivity Complement Component C5a [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_2150-C5_647.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")