FAM29A Antibody

Images

 
Immunohistochemistry-Paraffin: FAM29A Antibody [NBP1-88021] - Staining of human esophagus shows strong positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM29A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAUS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
FAM29A Protein (NBP1-88021PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM29A Antibody

  • Dgt6
  • dim gamma-tubulin homolog
  • FAM29AMGC102696
  • family with sequence similarity 29, member A
  • FLJ20060
  • HAUS augmin-like complex subunit 6
  • HAUS augmin-like complex, subunit 6
  • KIAA1574
  • MGC138798
  • MGC138799

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-92217
Species: Hu
Applications: IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00023071-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP2-05721
Species: Hu
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
AF5165
Species: Hu, Mu
Applications: WB
NBP1-88021
Species: Hu
Applications: IHC, IHC-P

Publications for FAM29A Antibody (NBP1-88021) (0)

There are no publications for FAM29A Antibody (NBP1-88021).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM29A Antibody (NBP1-88021) (0)

There are no reviews for FAM29A Antibody (NBP1-88021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM29A Antibody (NBP1-88021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM29A Products

Bioinformatics Tool for FAM29A Antibody (NBP1-88021)

Discover related pathways, diseases and genes to FAM29A Antibody (NBP1-88021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM29A Antibody (NBP1-88021)

Discover more about diseases related to FAM29A Antibody (NBP1-88021).

Blogs on FAM29A

There are no specific blogs for FAM29A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM29A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAUS6