FAM189B Antibody

Images

 
Western Blot: FAM189B Antibody [NBP1-98344] - Antibody Dilution: 1.0ug/ml Sample Tissue: Mouse Stomach.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM189B Antibody Summary

Immunogen
The immunogen for this antibody is Fam189b - C-terminal region. Peptide sequence LYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM189B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM189B Antibody

  • C1orf2
  • chromosome 1 open reading frame 2
  • cote1
  • family with sequence similarity 189, member B
  • hypothetical protein LOC10712
  • Protein COTE1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009522-P01
Species: Hu
AF5344
Species: Hu, Mu
Applications: WB
NBP2-47506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC, KO
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM189B Antibody (NBP1-98344) (0)

There are no publications for FAM189B Antibody (NBP1-98344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM189B Antibody (NBP1-98344) (0)

There are no reviews for FAM189B Antibody (NBP1-98344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM189B Antibody (NBP1-98344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FAM189B Antibody (NBP1-98344)

Discover related pathways, diseases and genes to FAM189B Antibody (NBP1-98344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM189B

There are no specific blogs for FAM189B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM189B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM189B
Uniprot