FAM134B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM134B Antibody [NBP2-55248] - Staining of human cell line HeLa shows localization to nuclear bodies & endoplasmic reticulum. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM134B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELLDQSELDQIESELGLTQDQEAEAQQNKKSSG
Specificity
Specificity of human FAM134B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM134B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP2-55248 in the following application:

Reactivity Notes

Mouse 86%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM134B Antibody

  • FAM134B protein
  • family with sequence similarity 134, member B
  • FLJ20152
  • FLJ22155
  • FLJ22179
  • HSAN2B
  • JK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69668
Species: Hu
Applications: WB
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-59643
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-60115
Species: Hu, Mu, Po, Bv, Ca, Eq, Gt, Sh
Applications: WB, IHC, IHC-P
NB100-1501
Species: Hu
Applications: WB, PEP-ELISA
NBP1-58010
Species: Hu, Mu, Rt, Eq, GP, Rb
Applications: WB
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-07087
Species: Hu
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF5129
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NB7276
Species: Ch
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF640
Species: Mu
Applications: WB, IHC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-55172
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NB100-1798
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS

Publications for FAM134B Antibody (NBP2-55248) (0)

There are no publications for FAM134B Antibody (NBP2-55248).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FAM134B Antibody (NBP2-55248) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse and Human.

Reviews using NBP2-55248:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FAM134B NBP2-55248
Enlarge
reviewed by:
Anonymous
WB Mouse and Human 05/12/2017
View

Summary

ApplicationWestern Blot
Sample TestedHEK293 cell lysate
SpeciesMouse and Human
LotR01726

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM134B Antibody (NBP2-55248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM134B Products

Bioinformatics Tool for FAM134B Antibody (NBP2-55248)

Discover related pathways, diseases and genes to FAM134B Antibody (NBP2-55248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM134B Antibody (NBP2-55248)

Discover more about diseases related to FAM134B Antibody (NBP2-55248).
 

Pathways for FAM134B Antibody (NBP2-55248)

View related products by pathway.

Blogs on FAM134B

There are no specific blogs for FAM134B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/12/2017
Application: WB
Species: Mouse and Human

Bioinformatics

Gene Symbol FAM134B