FAM108A1 Antibody

Images

 
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Human 293T. Antibody Dilution: 1.0ug/mlABHD17A is supported by BioGPS gene expression data to be expressed in HEK293T
Western Blot: FAM108A1 Antibody [NBP2-84877] - Host: Rabbit. Target Name: FAM108A1. Sample Type: Human Jurkat. Antibody Dilution: 1.0ug/mlABHD17A is supported by BioGPS gene expression data to be expressed in Jurkat

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM108A1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM108A1. Peptide sequence: VPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD17A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM108A1 Antibody

  • abhydrolase domain-containing protein FAM108A1
  • C19orf27
  • chromosome 19 open reading frame 27
  • EC 3.-
  • family with sequence similarity 108, member A1
  • MGC5244

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82746
Species: Hu
Applications: WB, IHC, IHC-P
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, IHC-WhMt
NBP2-13896
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-67618
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
H00005522-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF676
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF4055
Species: Mu
Applications: WB, Simple Western, IHC
NB200-305
Species: Hu, Mu, Pm, Rb
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
AF2690
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-84877
Species: Hu
Applications: WB

Publications for FAM108A1 Antibody (NBP2-84877) (0)

There are no publications for FAM108A1 Antibody (NBP2-84877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM108A1 Antibody (NBP2-84877) (0)

There are no reviews for FAM108A1 Antibody (NBP2-84877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM108A1 Antibody (NBP2-84877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM108A1 Products

Bioinformatics Tool for FAM108A1 Antibody (NBP2-84877)

Discover related pathways, diseases and genes to FAM108A1 Antibody (NBP2-84877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM108A1 Antibody (NBP2-84877)

Discover more about diseases related to FAM108A1 Antibody (NBP2-84877).
 

Pathways for FAM108A1 Antibody (NBP2-84877)

View related products by pathway.

Blogs on FAM108A1

There are no specific blogs for FAM108A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM108A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD17A