PPP2R2C Antibody (6D1)

Images

 
Western Blot: PPP2R2C Antibody (6D1) [H00005522-M01] - Analysis of PPP2R2C expression in transfected 293T cell line by PPP2R2C monoclonal antibody (M01), clone 6D1.Lane 1: PPP2R2C transfected lysate(49.5 KDa).Lane 2: ...read more
Western Blot: PPP2R2C Antibody (6D1) [H00005522-M01] - PPP2R2C monoclonal antibody (M01), clone 6D1 Analysis of PPP2R2C expression in HeLa.
ELISA: PPP2R2C Antibody (6D1) [H00005522-M01] - Detection limit for recombinant GST tagged PPP2R2C is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
6D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPP2R2C Antibody (6D1) Summary

Immunogen
PPP2R2C (NP_065149, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLST
Localization
Cytoplasmic
Specificity
PPP2R2C - protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP2R2C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00005522-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP2R2C Antibody (6D1)

  • B55-GAMMA
  • IMYPNO1
  • phosphoprotein phosphatase 2A BR gamma regulatory chain
  • PP2A subunit B isoform B55-gamma
  • PP2A subunit B isoform gamma
  • PP2A subunit B isoform PR55-gamma
  • PP2A subunit B isoform R2-gamma
  • PP2A, subunit B, B55-gamma isoform
  • PP2A, subunit B, B-gamma isoform
  • PP2A, subunit B, PR55-gamma isoform
  • PP2A, subunit B, R2-gamma isoform
  • PR55G
  • protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform
  • protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform
  • protein phosphatase 2
  • protein phosphatase 2, regulatory subunit B, gamma
  • protein phosphatase 2A1 B gamma subunit
  • serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform
  • serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform

Background

The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-32858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB120-22131
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45384
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-284
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R2C Antibody (H00005522-M01)(2)


Showing Publications 1 - 2 of 2.
Publications using H00005522-M01 Applications Species
Bluemn EG, Spencer ES, Mecham B et al. PPP2R2C Loss Promotes Castration-Resistance and Is Associated with Increased Prostate Cancer-Specific Mortality. Mol Cancer Res. 2013 Jun 06 [PMID: 23493267]
Elysia Sophia Spencer, Eric Gregory Bluemn, Richard Johnston et al. Association of decreased expression of protein phosphatase 2A subunit PR55{gamma} (PPP2R2C) with an increased risk of metastases and prostate cancer-specific mortality. Journal of Clinical Oncology 2012 May 20

Reviews for PPP2R2C Antibody (H00005522-M01) (0)

There are no reviews for PPP2R2C Antibody (H00005522-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R2C Antibody (H00005522-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PPP2R2C Products

Bioinformatics Tool for PPP2R2C Antibody (H00005522-M01)

Discover related pathways, diseases and genes to PPP2R2C Antibody (H00005522-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R2C Antibody (H00005522-M01)

Discover more about diseases related to PPP2R2C Antibody (H00005522-M01).
 

Pathways for PPP2R2C Antibody (H00005522-M01)

View related products by pathway.

PTMs for PPP2R2C Antibody (H00005522-M01)

Learn more about PTMs related to PPP2R2C Antibody (H00005522-M01).
 

Research Areas for PPP2R2C Antibody (H00005522-M01)

Find related products by research area.

Blogs on PPP2R2C

There are no specific blogs for PPP2R2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP2R2C Antibody (6D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R2C
Entrez
OMIM