RERG Antibody


Western Blot: RERG Antibody [NBP1-82746] - Analysis in control (vector only transfected HEK293T lysate) and RERG over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RERG Antibody [NBP1-82746] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RERG Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNK
Specificity of human RERG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RERG Protein (NBP1-82746PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RERG Antibody

  • MGC15754
  • RAS-like, estrogen-regulated, growth inhibitor
  • ras-related and estrogen-regulated growth inhibitor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC, IHC-P, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RERG Antibody (NBP1-82746) (0)

There are no publications for RERG Antibody (NBP1-82746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RERG Antibody (NBP1-82746) (0)

There are no reviews for RERG Antibody (NBP1-82746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RERG Antibody (NBP1-82746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RERG Antibody (NBP1-82746)

Discover related pathways, diseases and genes to RERG Antibody (NBP1-82746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RERG Antibody (NBP1-82746)

Discover more about diseases related to RERG Antibody (NBP1-82746).

Pathways for RERG Antibody (NBP1-82746)

View related products by pathway.

PTMs for RERG Antibody (NBP1-82746)

Learn more about PTMs related to RERG Antibody (NBP1-82746).

Blogs on RERG

There are no specific blogs for RERG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RERG Antibody and receive a gift card or discount.


Gene Symbol RERG