FAM103A1 Antibody

Images

 
Western Blot: FAM103A1 Antibody [NBP1-88436] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: FAM103A1 Antibody [NBP1-88436] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM103A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM103A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM103A1 Protein (NBP1-88436PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM103A1 Antibody

  • C15orf18HsT19360
  • family with sequence similarity 103, member A1
  • hypothetical protein LOC83640
  • MGC102778
  • MGC2560

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001446-D01P
Species: Hu, Mu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-81427
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM103A1 Antibody (NBP1-88436) (0)

There are no publications for FAM103A1 Antibody (NBP1-88436).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM103A1 Antibody (NBP1-88436) (0)

There are no reviews for FAM103A1 Antibody (NBP1-88436). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM103A1 Antibody (NBP1-88436) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM103A1 Products

Bioinformatics Tool for FAM103A1 Antibody (NBP1-88436)

Discover related pathways, diseases and genes to FAM103A1 Antibody (NBP1-88436). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FAM103A1 Antibody (NBP1-88436)

View related products by pathway.

PTMs for FAM103A1 Antibody (NBP1-88436)

Learn more about PTMs related to FAM103A1 Antibody (NBP1-88436).

Blogs on FAM103A1

There are no specific blogs for FAM103A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM103A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM103A1