FAK Antibody - BSA Free

Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunocytochemistry/Immunofluorescence: FAK Antibody [NBP1-84750] - Staining of human cell line U-2 OS shows localization to cytosol & focal adhesion sites. Antibody staining shown in green.

Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human testis shows moderate to cytoplasmic positivity in spermatogonia and Leydig cells.

Immunohistochemistry-Paraffin: FAK Antibody [NBP1-84750] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunocytochemistry/ Immunofluorescence: FAK Antibody [NBP1-84750] - Membrane surface receptor expression & metabolomic analysis of cells grown on porcine breast fatty tissue ECM hydrogel. Integrin beta 1 (a) or beta 4 (b) receptor (green) & FAK (red) expression in MM231 cells cultured on the ECM hydrogel-coated coverslips were assessed by IF. Phalloidin staining (white) of F-actin was used to contour the cells. Scale bars, 10 μm. (c) MS imaging of cross sections of the medium-conditioned blank (upper panels) & MM231 cell culture-laden (bottom panels) hydrogel scaffolds. (d) Examples of ROC (upper) & box-and-whiskers (bottom) plots from the MS imaging analysis, showing data for a compound with m/z 663.024, where differences between the hydrogel samples cultured with or without MM231 cells are clearly evident. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30257480), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Po, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAK Antibody - BSA Free (NBP1-84750) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-FAK Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
• Marker: Focal Adhesion Marker
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAK Protein (NBP1-84750PEP)

Reactivity Notes

Porcine reactivity reported in the scientific literature (PMID: 30257480).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FAK Antibody - BSA Free

• EC 2.7.10
• FADK 1
• FADK1
• FADKFAK-related non-kinase polypeptide
• FAK
• FAK1FRNK
• FAKEC 2.7.10.2
• focal adhesion kinase 1
• pp125FAK
• Protein-tyrosine kinase 2
• PTK2 protein tyrosine kinase 2
• PTK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAK Antibody (NBP1-84750)(1)

Publication using NBP1-84750

• Rijal G, Wang J, Yu I et al. Porcine Breast Extracellular Matrix Hydrogel for Spatial Tissue Culture. Int J Mol Sci. 2018-09-25 [PMID: 30257480] (ICC/IF, Porcine)

Bioinformatics

• Gene Symbol: PTK2