FADS3 Antibody - BSA Free

Western Blot: FADS3 Antibody [NBP2-87389] - Host: Rabbit. Target Name: Fads3. Sample Type: Rat Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FADS3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FADS3. Peptide sequence: DISRWAQRHPGGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGEL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FADS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FADS3 Antibody - BSA Free

• CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3
• Cytochrome b5-related protein
• delta-9 fatty acid desaturase
• delta-9-desaturase
• EC 1.14.19
• EC 1.14.19.-
• fatty acid desaturase 3
• LLCDL3

Background

The FADS3 gene encodes a 445 amino acid long, 51 kDA fatty acid desaturase 3 protein that, through the introduction of double bonds between carbons of the fatty acids, regulate unsaturation of fatty acids. FADS3 is associated with familial combined hyperlipidemia and coronary heart disease. FADS3 interacts with the UBC gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FADS3