FADS3 Antibody

Images

 
Western Blot: FADS3 Antibody [NBP2-87389] - Host: Rabbit. Target Name: Fads3. Sample Type: Rat Kidney lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FADS3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FADS3. Peptide sequence: DISRWAQRHPGGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGEL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FADS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FADS3 Antibody

  • CYB5RPlinoleoyl-CoA desaturase (delta-9-desaturase)-like 3
  • Cytochrome b5-related protein
  • delta-9 fatty acid desaturase
  • delta-9-desaturase
  • EC 1.14.19
  • EC 1.14.19.-
  • fatty acid desaturase 3
  • LLCDL3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16407
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82734
Species: Hu
Applications: IHC, IHC-P, WB
AF7550
Species: Hu
Applications: KO, WB
NBP1-84752
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00009197-M07
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
DTM100
Species: Hu
Applications: ELISA
NBP2-87389
Species: Rt
Applications: WB

Publications for FADS3 Antibody (NBP2-87389) (0)

There are no publications for FADS3 Antibody (NBP2-87389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADS3 Antibody (NBP2-87389) (0)

There are no reviews for FADS3 Antibody (NBP2-87389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FADS3 Antibody (NBP2-87389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FADS3 Products

Bioinformatics Tool for FADS3 Antibody (NBP2-87389)

Discover related pathways, diseases and genes to FADS3 Antibody (NBP2-87389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FADS3 Antibody (NBP2-87389)

Discover more about diseases related to FADS3 Antibody (NBP2-87389).
 

Pathways for FADS3 Antibody (NBP2-87389)

View related products by pathway.

Research Areas for FADS3 Antibody (NBP2-87389)

Find related products by research area.

Blogs on FADS3

There are no specific blogs for FADS3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FADS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FADS3