Factor XII heavy chain Antibody (3A3)

Images

 
Proximity Ligation Assay: Factor XII heavy chain Antibody (3A3) [H00002161-M01] - Analysis of protein-protein interactions between GP1BA and F12. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 ...read more
Sandwich ELISA: Factor XII heavy chain Antibody (3A3) [H00002161-M01] - Detection limit for recombinant GST tagged F12 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func
Clone
3A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Factor XII heavy chain Antibody (3A3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
F12 (AAH12390, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS
Specificity
F12 - coagulation factor XII (Hageman factor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Factor XII heavy chain Antibody (3A3)

  • beta-factor XIIa part 1
  • coagulation factor XII (Hageman factor)
  • coagulation factor XII
  • coagulation factor XIIa heavy chain
  • coagulation factor XIIa light chain
  • EC 3.4.21
  • EC 3.4.21.38
  • HAE3
  • HAEX
  • HAFbeta-factor XIIa part 2
  • Hageman factor

Background

This gene encodes coagulation factor XII which circulates in blood as a zymogen. This single chain zymogen is converted to a two-chain serine protease with an heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain and a proline-rich domain, whereas the light chain contains only a catalytic domain. On activation, further cleavages takes place in the heavy chain, resulting in the production of beta-factor XIIa light chain and the alpha-factor XIIa light chain becomes beta-factor XIIa heavy chain. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then to beta-factor XIIa. The active factor XIIa participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates coagulation factors VII and XI. Defects in this gene do not cause any clinical symptoms and the sole effect is that whole-blood clotting time is prolonged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
2914-HT
Species: Hu
Applications: BA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
1719-SE
Species: Hu
Applications: EnzAct
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
233-FB
Species: Hu
Applications: BA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
291-G1
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for Factor XII heavy chain Antibody (H00002161-M01) (0)

There are no publications for Factor XII heavy chain Antibody (H00002161-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor XII heavy chain Antibody (H00002161-M01) (0)

There are no reviews for Factor XII heavy chain Antibody (H00002161-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor XII heavy chain Antibody (H00002161-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Factor XII heavy chain Products

Diseases for Factor XII heavy chain Antibody (H00002161-M01)

Discover more about diseases related to Factor XII heavy chain Antibody (H00002161-M01).
 

Pathways for Factor XII heavy chain Antibody (H00002161-M01)

View related products by pathway.

PTMs for Factor XII heavy chain Antibody (H00002161-M01)

Learn more about PTMs related to Factor XII heavy chain Antibody (H00002161-M01).

Blogs on Factor XII heavy chain

There are no specific blogs for Factor XII heavy chain, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Factor XII heavy chain Antibody (3A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol F12
Entrez
OMIM
Uniprot